Gene Details:

  • Gene ID: Achn311681
  • Gene Family: MYB_related Family
  • Description: MYB_related Family protein
  • Species: Actinidia chinensis
  • Source: MYB_related family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_002311313.2  — transcription factor MYB106
  • Swissprot:  Q9LE63  — MY106_ARATH; Transcription factor MYB106
  • TrEMBL:  B9HI92  — B9HI92_POPTR; Uncharacterized protein
  • STRING:  POPTR_0008s08920.1  — (Populus trichocarpa)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • A novel myb-like gene (AtmybL2) was isolated from an Arabidopsis thaliana cDNA library. The single copy gene was localised on chromosome I. A gene specific transcript is preferentially found in leaves. The predicted gene product consists of a conservative N-terminal myb-domain known to be involved in DNA-binding and a unique proline-rich C-terminal part. Remarkably, the myb-domain includes only one of the typical two or three tryptophan repeats found in other myb-like proteins.

Literature:

Sequences:

CDS Sequence:
  • >Achn311681|Actinidia_chinensis|MYB_related|Achn311681
    ATGGTGGTGGTACATGGACTTGGATTGGTGATAAAGAAGGGGCCCTGGACACCTGAAGAGGATCAGAAGCTGTTGGCTTACATTGAAGAACATGGACATGGAAGCTGGCGTGCCTTGCCTGTGAAAGCAGGAGTACGAGTTGCTTTTAAATAA
Protein Sequence:
  • >Achn311681|Actinidia_chinensis|MYB_related|Achn311681
    MVVVHGLGLVIKKGPWTPEEDQKLLAYIEEHGHGSWRALPVKAGVRVAFK*