Information report for MELO3C017292P1
Gene Details
|
|
Functional Annotation
- Refseq: XP_008453372.1 — PREDICTED: transcription factor DIVARICATA
- Swissprot: B8A9B2 — MYBS1_ORYSI; Transcription factor MYBS1
- Swissprot: Q8LH59 — MYBS1_ORYSJ; Transcription factor MYBS1
- TrEMBL: A0A1S3BX90 — A0A1S3BX90_CUCME; transcription factor DIVARICATA
- STRING: XP_008453372.1 — (Cucumis melo)
- GO:0009651 — Biological Process — response to salt stress
- GO:0009733 — Biological Process — response to auxin
- GO:0009739 — Biological Process — response to gibberellin
- GO:0009751 — Biological Process — response to salicylic acid
- GO:0009753 — Biological Process — response to jasmonic acid
- GO:0046686 — Biological Process — response to cadmium ion
- GO:0003677 — Molecular Function — DNA binding
Family Introduction
- MYB factors represent a family of proteins that include the conserved MYB DNA-binding domain.The first MYB gene identified was the ‘oncogene’ v-Myb derived from the avian myeloblastosis virus . Evidence obtained from sequence comparisons indicates that v-Myb may have originated from a vertebrate gene, which mutated once it became part of the virus. Many vertebrates contain three genes related to v-Myb c-Myb, A-Myb and B-Myb and other similar genes have been identified in insects, plants, fungi and slime moulds. The encoded proteins are crucial to the control of proliferation and differentiation in a number of cell types, and share the conserved MYB DNA-binding domain. This domain generally comprises up to three imperfect repeats, each forming a helix-turn-helix structure of about 53 amino acids. Three regularly spaced tryptophan residues, which form a tryptophan cluster in the three-dimensional helix-turn-helix structure, are characteristic of a MYB repeat. The three repeats in c-Myb are referred to as R1, R2 and R3; and repeats from other MYB proteins are categorised according to their similarity to either R1, R2 or R3.
- In contrast to animals, plants contain a MYB-protein subfamily that is characterised by the R2R3-type MYB domain. MYB proteins can be classified into three subfamilies depending on the number of adjacent repeats in the MYB domain (one, two or three). We refer to MYB-like proteins with one repeat as ‘MYB1R factors’, with two as ‘R2R3-type MYB’ factors, and with three repeats as ‘MYB3R’ factors.
Literature and News
Gene Resources
Homologs
- Actinidia chinensis: Achn145641
- Artemisia annua: Aan000862
- Cajanus cajan: C.cajan_01831
- Capsicum annuum: CA03g33870
- Citrullus lanatus: Cla018988
- Cucumis sativus: Cucsa.198920.1
- Glycine max: Glyma.17G121000.1.p, Glyma.05G013000.1.p
- Gossypium hirsutum: Gh_D09G0462, Gh_A09G0455
- Juglans regia: WALNUT_00013425-RA
- Nicotiana benthamiana: Niben101Scf00725g03014.1
- Populus trichocarpa: Potri.012G060300.1
- Ricinus communis: 30174.m008717
- Solanum lycopersicum: Solyc03g119740.2.1
- Solanum melongena: Sme2.5_03124.1_g00002.1
- Solanum tuberosum: PGSC0003DMP400009906
- Ziziphus jujuba: XP_015883030.1
Sequences
CDS Sequence:
- >MELO3C017292P1|Cucumis_melo|MYB|MELO3C017292P1
ATGTCGACGGGATCAGCTGTTTGGACCAAAGAAGAAGATAAAGCATTTGAAAATGCTATAGCCACGCATTGGGGTGAAGAATTGGAAGGGAGTAAGGGGTCAGAAGAGATGTGGGAAAAGATTGCTTCCATGGTTCCAAGTAAGAACATGGAAGACTTGAAGCAGCACTATCAAATGCTGGTGGACGATGTTGGTGCTATTGAGGCAGGCCAAATTCCTATTCCTAACTATGCTTCTTCTGTTGGAGAAGAAACTGCTTCCACTAAGGAGAAGGATCATCATCTTCATCCTCACGGAGCTTCTGATAGTAATAAAAGACCAAATTCTGGTTTTGGAAGTGGGTTTTCTGGGCTCTCCCACGACTCGTCTGCCCACGCCACAAAGGGTGGATCCAGGTCTGAGCAAGAAAGAAGGAAAGGAATCCCATGGACAGAGGAAGAACACAGGTTATTTCTACTGGGTCTAGATAAGTTTGGGAAAGGGGATTGGAGAAGCATTTCAAGAAACTTCGTTATATCCCGAACACCGACTCAAGTGGCCAGTCATGCACAGAAGTACTTCATACGATTGAACTCAATGAACAGAGATAGAAGACGATCAAGTATTCATGACATAACCTCAGTTAATAATGGCGGTGGTGGCGATGTCATGTCCCATCAAGCTCCGATCACTGGCCACCAGACAAACGGCACGAACCAGAGTAATCCGCCGGCTTTGGGACCGCCAGGGAAGCACCGGCCTCAACAGCATCTGCCCGGAATAGGCATGTACGGAGCACCTGTTGGGCAACCAGTGGCAGCTCCTCCAGGGCACATAGCATCAGCGGTTGGCACTCCAGTGATGCTTCCTCAAGGAATCCATCCCCATCCTCCATATGTTATGCCAGTTGCTTATCCAATGGCACCTCCACCAATGCACCAATGA
Protein Sequence:
- >MELO3C017292P1|Cucumis_melo|MYB|MELO3C017292P1
MSTGSAVWTKEEDKAFENAIATHWGEELEGSKGSEEMWEKIASMVPSKNMEDLKQHYQMLVDDVGAIEAGQIPIPNYASSVGEETASTKEKDHHLHPHGASDSNKRPNSGFGSGFSGLSHDSSAHATKGGSRSEQERRKGIPWTEEEHRLFLLGLDKFGKGDWRSISRNFVISRTPTQVASHAQKYFIRLNSMNRDRRRSSIHDITSVNNGGGGDVMSHQAPITGHQTNGTNQSNPPALGPPGKHRPQQHLPGIGMYGAPVGQPVAAPPGHIASAVGTPVMLPQGIHPHPPYVMPVAYPMAPPPMHQ*