Gene Details:
- Gene ID: Zm00001eb257340
- Gene Symbol: ZmMKK4
- Gene Name: MAP kinase kinase4
- Genome: Zm-B73-REFERENCE-NAM-5.0
- Species: Zea mays
Functional Descriptions:
- ZmMKK4, a novel group C mitogen-activated protein kinase kinase in maize (Zea mays), confers salt and cold tolerance in transgenic Arabidopsis.
- Over-expression of ZmMKK4 in Arabidopsis conferred tolerance to cold and salt stresses by increased germination rate, lateral root numbers, plant survival rate, chlorophyll, proline and soluble sugar contents, and antioxidant enzyme [peroxidase (POD), catalase (CAT)] activities compared with control plants.
- ZmMKK4 enhanced a 37 kDa kinase activity after cold and salt stresses. RT-PCR analysis revealed that the transcript levels of stress-responsive transcription factors and functional genes were higher in ZmMKK4-over-expressing plants than in control plants.
- ZmMKK4 protein is localized in the nucleus. Taken together, these results indicate that ZmMKK4 is a positive regulator of salt and cold tolerance in plants.
Function-related keywords:
- root , kinase , stress , salt , tolerance , nucleus , cold-tolerance , cold-stress , salt-tolerance , salt-stress , cold , stress-tolerance , protein-kinase , sugar , chlorophyll , lateral-root , transcription-regulator , catalase , protein
Literature:
- ZmMKK4, a novel group C mitogen-activated protein kinase kinase in maize (Zea mays), confers salt and cold tolerance in transgenic Arabidopsis. DOI: 10.1111/j.1365-3040.2011.02329.x ; PMID: 21477122
Related News:
Gene Resources:
- NCBI ID: LOC100281486
- UniProt accessions: B6UF44
Orthologs:
Sequences:
cDNA Sequence
- >Zm00001eb254900_T001
ATGTCGAGCCGGAGGCCGTCGTCGCGTGGCAACATCTCCGAGGACGAGATCAACGAGCTCATCTCCAAGCTGCAGGCCCTGCTCCCCAGCTCCCGCCGCCGCGGCTCCGGCCAGGCGTCGACGACGAAGCTGCTCAAGGAGACCTGCAGCTACATCAAGAGCCTGCACCGGGAGGTGGACGACCTGAGCGACCGGCTGTCCGACCTCATGGCCACCATGGACCACAACAGCCCCGGCGCGGAGATCATCCGCAGCATCCTCCGCTCCTGA
CDS Sequence
- >Zm00001eb254900_T001
ATGTCGAGCCGGAGGCCGTCGTCGCGTGGCAACATCTCCGAGGACGAGATCAACGAGCTCATCTCCAAGCTGCAGGCCCTGCTCCCCAGCTCCCGCCGCCGCGGCTCCGGCCAGGCGTCGACGACGAAGCTGCTCAAGGAGACCTGCAGCTACATCAAGAGCCTGCACCGGGAGGTGGACGACCTGAGCGACCGGCTGTCCGACCTCATGGCCACCATGGACCACAACAGCCCCGGCGCGGAGATCATCCGCAGCATCCTCCGCTCCTGA
Protein Sequence
- >Zm00001eb254900_P001
MSSRRPSSRGNISEDEINELISKLQALLPSSRRRGSGQASTTKLLKETCSYIKSLHREVDDLSDRLSDLMATMDHNSPGAEIIRSILRS
Source: Genetic information comes from the article