Gene Details:
- Gene ID: TraesCS5B02G045100
- Gene Symbol: TaWIR1a
- Gene Name: Wheat-Induced Resistance 1
- Genome: Chinese_Spring1.0
- Species: Triticum aestivum
Functional Descriptions:
- TaWIR1 contributes to post-penetration resistance to Magnaporthe oryzae, but not Blumeria graminis f. sp. tritici, in wheat.
- Transcripts of all three TaWIR1 genes were strongly induced by a wheat-adapted isolate of Magnaporthe oryzae.
- Virus-induced gene silencing of the TaWIR1 gene family had no effect on the initial penetration of epidermal cells by M.oryzae.
- Silencing of TaWIR1 transcripts had no effect on epidermal cell penetration by a wheat-adapted isolate of Blumeria graminis, or on the subsequent growth of hyphae.
- Differential transcription of TaWIR1 genes was also seen in epidermal peels, relative to the remaining leaf tissue, following inoculation with M.oryzae.
Function-related keywords:
- leaf , growth , resistance , magnaporthe-oryzae , virus
Literature:
- TaWIR1 contributes to post-penetration resistance to Magnaporthe oryzae, but not Blumeria graminis f. sp. tritici, in wheat. DOI: 10.1111/j.1364-3703.2011.00775.x ; PMID: 22243838
Related News:
Gene Resources:
Orthologs:
Sequences:
cDNA Sequence
- >TraesCS5B02G045100.1
ATGGCGTCCCTGGGTAGCAGCGCTGGCGGCCGTCGTCCCACGGTGCTCCTGCAGATCGCTCTCTTCGTCGTCGTCGCCGCGATCATCATCAACAGCTCCGTCTGCCTTGGAGCCACGGCCGTCCACGACGCCGCCGCCTCAGGCACCGGTGCTCTCGACCCTAACGTCCCTGCTGTTCCGACGCCGGGCGGTGCCGGTCAACCCTACACCGGCCGTGGGTGCCGCACAGTTTACGGATGTAGACCACCGGCGGGTGGCCAGCCCTAA
CDS Sequence
- >TraesCS5B02G045100.1
ATGGCGTCCCTGGGTAGCAGCGCTGGCGGCCGTCGTCCCACGGTGCTCCTGCAGATCGCTCTCTTCGTCGTCGTCGCCGCGATCATCATCAACAGCTCCGTCTGCCTTGGAGCCACGGCCGTCCACGACGCCGCCGCCTCAGGCACCGGTGCTCTCGACCCTAACGTCCCTGCTGTTCCGACGCCGGGCGGTGCCGGTCAACCCTACACCGGCCGTGGGTGCCGCACAGTTTACGGATGTAGACCACCGGCGGGTGGCCAGCCCTAA
Protein Sequence
- >TraesCS5B02G045100.1
MASLGSSAGGRRPTVLLQIALFVVVAAIIINSSVCLGATAVHDAAASGTGALDPNVPAVPTPGGAGQPYTGRGCRTVYGCRPPAGGQP