Gene Details:
- Gene ID:
- Gene Symbol: TaMs1-B
- Gene Name: MALE STERILITY 1
- Genome: Chinese_Spring1.0
- Species: Triticum aestivum
Functional Descriptions:
- Wheat TaMs1 is a glycosylphosphatidylinositol-anchored lipid transfer protein necessary for pollen development.
- TaMs1, a dominant wheat fertility gene located on chromosome 4BS, has been previously fine mapped and identified to encode a glycosylphosphatidylinositol (GPI)-anchored non-specific lipid transfer protein (nsLTP).
- TaMs1 was identified to be expressed at an earlier stage of anther development relative to genes reported to be necessary for sporopollenin precursor biosynthesis.
- Exogenous hormone treatments on GUS reporter lines suggest that TaMs1 expression is increased by both indole-3-acetic acid (IAA) and abscisic acid (ABA). Translational fusion constructs showed that TaMs1 is targeted to the plasma membrane.
- TaMs1 is a wheat fertility gene, expressed early in anther development and encodes a GPI-LTP targeted to the plasma membrane.
- TaMs1 knock-out does not affect the expression level of genes involved in anthers and pollen wall development at meiosis stage.
Function-related keywords:
- development , fertility , pollen , anther , pollen-development , pollen-wall , aba , iaa , meiosis , abscisic-acid , anther-development , plasma-membrane , aba-biosynthesis , iaa-biosynthesis , pollen-fertility , abscisic-acid-biosynthesis , protein
Literature:
- Wheat TaMs1 is a glycosylphosphatidylinositol-anchored lipid transfer protein necessary for pollen development. DOI: 10.1186/s12870-018-1557-1 ; PMID: 30518316
- Molecular identification of the wheat male fertility gene Ms1 and its prospects for hybrid breeding. DOI: 10.1038/s41467-017-00945-2 ; PMID: 29021581
Related News:
Gene Resources:
- NCBI ID: KX447407
- UniProt accessions: A0A1D5XS12
Orthologs:
Sequences:
cDNA Sequence
CDS Sequence
- >KX447407
ATGGAGAGATCCCGCGGGCTGCTGCTGGTGGCGGGGCTGCTGGCGGCGCTGCTGCCGGCGGCGGCGGCGCAGCCGGGGGCGCCGTGCGAGCCCGCGCTGCTGGCGACGCAGGTGGCGCTCTTCTGCGCGCCCGACATGCCGACGGCCCAGTGCTGCGAGCCCGTCGTCGCCGCCGTCGACCTCGGCGGCGGGGTGCCCTGCCTCTGCCGCGTCGCCGCCGAGCCGCAGCTCGTCATGGCGGGCCTCAACGCCACCCACCTCCTCACGCTCTACAGCTCCTGCGGCGGCCTCCGCCCCGGCGGCGCCCACCTCGCCGCCGCCTGCGAAGGACCCGCTCCCCCGGCCGCCGTCGTCAGCAGCCCCCCGCCCCCGCCTCCACCGTCCGCCGCACCTCGCCGCAAGCAGCCAGCGCACGACGCACCACCGCCGCCACCGCCGTCGAGCGAGAAGCCGTCGTCCCCGCCGCCGTCCCAGGACCACGACGGCGCCGCCCCCCGCGCCAAGGCCGCGCCCGCCCAGGCGGCCACCTCCACGCTCGCGCCCGCCGCCGCCGCCACCGCCCCGCCGCCCCAGGCGCCGCACTCCGCCGCGCCCACGGCGCCGTCCAAGGCGGCCTTCTTCTTCGTCGCCACGGCCATGCTCGGCCTCTACATCATCCTCTGA
Protein Sequence
- >KX447407
MERSRGLLLVAGLLAALLPAAAAQPGAPCEPALLATQVALFCAPDMPTAQCCEPVVAAVDLGGGVPCLCRVAAEPQLVMAGLNATHLLTLYSSCGGLRPGGAHLAAACEGPAPPAAVVSSPPPPPPPSAAPRRKQPAHDAPPPPPPSSEKPSSPPPSQDHDGAAPRAKAAPAQAATSTLAPAAAATAPPPQAPHSAAPTAPSKAAFFFVATAMLGLYIIL