Gene Details:
- Gene ID:
- Gene Symbol: TaBln1-5B
- Gene Name: BLN1
- Genome: Chinese_Spring1.0
- Species: Triticum aestivum
Functional Descriptions:
- TaBln1, a member of the Blufensin family, negatively regulates wheat resistance to stripe rust by reducing Ca2+ influx.
- Silencing TaBln1 increased the Ca2+ influx in vivo using a noninvasive micro-test technique.
- Wheat susceptibility factor TaBln1, which interacts with TaCaM3 to impair Ca2+ influx and inhibit plant defenses.
- Knockdown of TaBln1 expression by virus-induced gene silencing reduced Pst growth and development, and enhanced the host defense response.
- TaBln1 was found to physically interact with a calmodulin, TaCaM3, on the plasma membrane.
- Identified the wheat susceptibility factor TaBln1, which interacts with TaCaM3 to impair Ca2+ influx and inhibit plant defenses.
Function-related keywords:
- growth , development , resistance , plant-development , defense-response , defense , plant-growth , plasma-membrane , rust-resistance , rust
Literature:
- TaBln1, a member of the Blufensin family, negatively regulates wheat resistance to stripe rust by reducing Ca2+ influx. DOI: 10.1093/plphys/kiac112 ; PMID: 35285499
Related News:
Gene Resources:
- NCBI ID: OM803180
- UniProt accessions: A0A9E8IL17
Sequences:
cDNA Sequence
- >OM803180
ATGGTGAAGAACAACTCCTCTGCGACCTCGGTTCGGCTGATGCTGATCCTCCTCGTTCTGCTGGTTTTCGTTGGTGGCATCCTTGCAAACGATGGGCCGTCCAAATGCAGCAACCCTGCGGCTCAGCAAAACTGCCCGTCGATCCCTAATGGCGGCTCATAA
CDS Sequence
- >OM803180
ATGGTGAAGAACAACTCCTCTGCGACCTCGGTTCGGCTGATGCTGATCCTCCTCGTTCTGCTGGTTTTCGTTGGTGGCATCCTTGCAAACGATGGGCCGTCCAAATGCAGCAACCCTGCGGCTCAGCAAAACTGCCCGTCGATCCCTAATGGCGGCTCATAA
Protein Sequence
- >OM803180
MVKNNSSATSVRLMLILLVLLVFVGGILANDGPSKCSNPAAQQNCPSIPNGGS