Information report for Ciclev10001952m
Gene Details
|
|
Functional Annotation
- Refseq: XP_006435006.1 — zinc-finger homeodomain protein 5
- Swissprot: Q9FRL5 — ZHD5_ARATH; Zinc-finger homeodomain protein 5
- TrEMBL: V4TF06 — V4TF06_9ROSI; Uncharacterized protein
- STRING: XP_006435006.1 — (Citrus clementina)
- GO:0009737 — Biological Process — response to abscisic acid
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0042803 — Molecular Function — protein homodimerization activity
Family Introduction
- This group of sequences described by a 54-residue domain found in the N-terminal region of plant proteins, the vast majority of which contain a ZF-HD class homeobox domain toward the C terminus. The region between the two domains typically is rich in low complexity sequence. The companion ZF-HD homeobox domain is described in INTERPRO:IPR006455.
- A one-hybrid screen resulted in the cloning of four different members of a novel class of plant homeodomain proteins, which are most likely involved in the mesophyll-specific expression of the C4 PEPCase gene in C4 species of the genus Flaveria. Inspection of the homeodomains of the four proteins reveals that they share many common features with homeodomains described so far, but there are also significant differences. Interestingly, this class of homeodomain proteins occurs also in Arabidopsis thaliana and other C3 plants. One-hybrid experiments as well as in vitro DNA binding studies confirmed that these novel homeodomain proteins specifically interact with the proximal region of the C4 PEPCase (C4 phosphoenolpyruvate carboxylase) gene. The N-terminal domains of the homeodomain proteins contain highly conserved sequence motifs. Two-hybrid experiments show that these motifs are sufficient to confer homo- or heterodimer formation between the proteins. Mutagenesis of conserved cysteine residues within the dimerization domain indicates that these residues are essential for dimer formation. Therefore, we designate this novel class of homeobox proteins ZF-HD, for zinc finger homeodomain protein. Our data suggest that the ZF-HD class of homeodomain proteins may be involved in the establishment of the characteristic expression pattern of the C4 PEPCase gene.
Literature and News
Gene Resources
Homologs
- Citrus sinensis: orange1.1g021941m
- Cucumis melo: MELO3C010949P1
- Cucumis sativus: Cucsa.232110.1
- Gossypium arboreum: Cotton_A_38394_BGI-A2_v1.0
- Gossypium hirsutum: Gh_D01G0982, Gh_A01G0938, Gh_A05G1654, Gh_D05G1843
- Manihot esculenta: Manes.05G158500.1.p, Manes.18G023700.1.p
- Populus trichocarpa: Potri.002G035200.2, Potri.002G035200.1, Potri.005G227900.1
- Ricinus communis: 30170.m014054
Sequences
CDS Sequence:
- >Ciclev10001952m|Citrus_clementina|ZF-HD|Ciclev10001952m
ATGATGATGGAGATTAAGCAAGAAAACGAAACAAAAACTCCAAGAAGAGATGGGAATAATGACAATGGTACCGCAGTGTACAGTTTCAATACTCATCAAACCCTAGATCATAATTTACAACGCCAGCAGCAGCAGCAGCAAGCGAGATCTCCAAACCCAGATCGAGTTACTAGTGTGATTGGTGCCGCAATTGCACCAATCTCCGCAGGATCCAACTCCAAGCCACCCATTAACGTGATCCGGTATCGAGAATGCCTCAAGAACCACGCAGCCTGCATTGGTGGCAACATCTTCGATGGGTGCGGTGAGTTCATGCCTAGCGGGGATGAAGGCACATTGGAAGCCTTGAAATGCGCGGCTTGTGAGTGCCACAGAAACTTTCACCGCAAAGAGATCGATGGGGAGACTGCCCAATTGATCAGCACCGGTAGAAGATCGGCTGTTATGCTGAATCCACTGCAGCTTCCTCCACCGTTGCCATCTCCGACGATGATGCATCACCATCATCATCATCAGAAGTATTCGATAAGCAGGCACACGATGAGCCCATCAAGTGCAATTGTTGCACCAATGAATGTGGCATTTGGTGGTGGGATTAGTGAGTCTTCAAGTGAAGATCTTAGTAATGTGCTTCATTCTGAGGGAGTGCTACAGCATCAGCCACCAGCGGCACCCCCACCGCCACCTCCTTTTGTTTTGTCAAAGAAGCGCTTCCGAACCAAGTTCACGCAGGAGCAAAAGGACAAGATGATGGAGTTTGCTGAGAAAGTTGGGTGGCGCTTTCAGAAGCAAGACGATGATCAAGTTGACAAGTTTTGTGCTGAAGTTGGAATTAAGAGGCATGTCTTCAAAGTTTGGATGCACAATAACAAGAACAATATTGTCAAGAATAAGCAAGAACCTGCTGCTGACCCCGTGTAA
Protein Sequence:
- >Ciclev10001952m|Citrus_clementina|ZF-HD|Ciclev10001952m
MMMEIKQENETKTPRRDGNNDNGTAVYSFNTHQTLDHNLQRQQQQQQARSPNPDRVTSVIGAAIAPISAGSNSKPPINVIRYRECLKNHAACIGGNIFDGCGEFMPSGDEGTLEALKCAACECHRNFHRKEIDGETAQLISTGRRSAVMLNPLQLPPPLPSPTMMHHHHHHQKYSISRHTMSPSSAIVAPMNVAFGGGISESSSEDLSNVLHSEGVLQHQPPAAPPPPPPFVLSKKRFRTKFTQEQKDKMMEFAEKVGWRFQKQDDDQVDKFCAEVGIKRHVFKVWMHNNKNNIVKNKQEPAADPV*