Gene Details:
- Gene ID: MDP0000600720
- Gene Family: WOX Family
- Description: WOX Family protein
- Species: Malus domestica
- Source: WOX family gene from PlantTFDB
Protein Features:
- SuperFamily: SSF46689
- PROSITE profile: PS50071
- SMART: SM00389
- Pfam: PF00046
- Gene3D: G3DSA:1.10.10.60
- InterPro: IPR009057 IPR001356
Annotation Proteins:
- Refseq: XP_008392988.1 — WUSCHEL-related homeobox 7-like
- Swissprot: Q8H1D2 — WOX5_ARATH; WUSCHEL-related homeobox 5
- TrEMBL: A0A498JFZ2 — A0A498JFZ2_MALDO; Uncharacterized protein
- STRING: XP_008392988.1 — (Malus domestica)
Gene Ontology:
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- A homeobox (HB) encodes a protein domain, the homeodomain (HD), which is a conserved 60-amino acid motif present in transcription factors found in all the eukaryotic organisms. This 60-amino acid sequence folds into a characteristic three-helix structure that is able to interact specifically with DNA. Most HDs are able to bind DNA as monomers with high affinity, through interactions made by helix III (the so-called recognition helix) and a disordered N-terminal arm located beyond helix I. The high degree of conservation of this type of domain among diverse proteins from different kingdoms indicates that this structure is crucial to maintain the HD functionality and that the role played by this domain is vital.
- The WOX genes form a plant-specific subclade of the eukaryotic homeobox transcription factor superfamily, which is characterized by the presence of a conserved DNA-binding homeodomain. The analysis of WOX gene expression and function shows that WOX family members fulfill specialized functions in key developmental processes in plants, such as embryonic patterning, stem-cell maintenance and organ formation. These functions can be related to either promotion of cell division activity and/or prevention of premature cell differentiation.
Literature:
- The WUS homeobox-containing (WOX) protein family. DOI: 10.1186/gb-2009-10-12-248 ; PMID: 20067590
- The true story of the HD-Zip family. DOI: 10.1016/j.tplants.2007.08.003 ; PMID: 17698401
Sequences:
CDS Sequence:
- >MDP0000600720|Malus_domestica|WOX|MDP0000600720
ATGGACGATGGCATGTCAGGGTTTTGCATTAAAGCATCGAGTTTTCGCAGTGGTGGTGACGGTGGTAATGGTAATAGTGGAACCAAGTGCGGGCGTTGGAATCCAACTATTGAACAGGTTAAAGTGCTGACTGACCTGTTTAGGTCTGGACTCCGAACGCCGAGCACTGATCAGATTCAGAAAATCTCCTCTCAGCTAAGCTTTTATGGAAAGATCGAGAGCAAGAACGTCTTTTACTGGTTTCAGAATCACAAAGCCAGAGAAAGACAAAAGCGGCGTAAAGTTTCTATTGATGACAAGGATATCATTCGTCGAGATCAGGAGAACAAGCCGTCTCCAAAACAAATAAATCAGGTGTCGGAGCCGGTGAGAGTGATTGAGACCCTTCAACTTTTCCCGATAAACTCTTTAAACGAATCTGAAGGAGAGAAGCTGAGATTTCATGCAAACGAATATTGCAAGGAGGCATCAGCTTTTACTTACACTGTTGGGACAGAAATGGACCTTCCACCTTTGGATCTGCGCTTAAGTTTCCATTAA
Protein Sequence:
- >MDP0000600720|Malus_domestica|WOX|MDP0000600720
MDDGMSGFCIKASSFRSGGDGGNGNSGTKCGRWNPTIEQVKVLTDLFRSGLRTPSTDQIQKISSQLSFYGKIESKNVFYWFQNHKARERQKRRKVSIDDKDIIRRDQENKPSPKQINQVSEPVRVIETLQLFPINSLNESEGEKLRFHANEYCKEASAFTYTVGTEMDLPPLDLRLSFH*