Gene Details:

  • Gene ID: GSBRNA2T00057787001
  • Gene Name: GSBRNA2T00057787001, GSBRNA2T00087190001
  • Gene Family: Whirly Family
  • Description: Whirly Family protein
  • Species: Brassica napus
  • Source: Whirly family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009110543.1  — PREDICTED: single-stranded DNA-binding protein WHY1, chloroplastic
  • Swissprot:  Q9M9S3  — WHY1_ARATH; Single-stranded DNA-binding protein WHY1, chloroplastic
  • TrEMBL:  A0A078JNN5  — A0A078JNN5_BRANA; BnaAnng23380D protein
  • STRING:  Bra016702.1-P  — (Brassica rapa)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • Members of the Whirly family of proteins are found throughout the plant kingdom and are predicted to share the ability to bind to single-stranded DNA. Arabidopsis and potato Whirly orthologs act as transcription factors that regulate defense gene expression; the Arabidopsis Whirly protein AtWhy1 contributes to both basal and specific defense responses. Analysis of the crystal structure of potato StWhy1 has provided insight into the DNA-binding mechanism of this family of proteins, their mode of action and possible autoregulation. There is evidence to suggest that Whirly proteins might play roles in processes other than defense responses and could function in the chloroplast as well as in the nucleus.

Literature:

Sequences:

CDS Sequence:
  • >GSBRNA2T00057787001|Brassica_napus|Whirly|GSBRNA2T00057787001
    ATGTCGCAGCTCTTATCTTCCCCTTTGGTGGCGTTAAGTTACAACCCCTTTGCTAGCCCTCGCTTTCTCTCTTCGTCTTCTTCAGTACTCGTCGCCACCGGCGGTCTCGCCGTGAAACGACATGTACTAGCCTCGAAGCCGACGAAGACGGTGAAGCTCACTGTTAAGTCCCGACAGACGGATTACTTCGAGAAGCAGAGGTTCGGTGACTCGTCAGAACGGGTACTCTCAAAGTGTGAAGGAGGGCCTGCTAGGTTTTACGTGGGTCATTCGATATACAAAGGGAAAGCTGCGGTCACGGTGGAGCCAAGAGCACCAGAGTTTGTGTCTTTAGACTCTGGAGCTTTCAAGTTGTCGAAAGACGGTTCTTTACTGCTTCAGTTTGCTCCTGCAGCTGGTGTGAGGCAATACGATTGGAGCAAGAAGCAGGTTTGGTTTCATCCTTTTAACTTCAGATGA
Protein Sequence:
  • >GSBRNA2T00057787001|Brassica_napus|Whirly|GSBRNA2T00057787001
    MSQLLSSPLVALSYNPFASPRFLSSSSSVLVATGGLAVKRHVLASKPTKTVKLTVKSRQTDYFEKQRFGDSSERVLSKCEGGPARFYVGHSIYKGKAAVTVEPRAPEFVSLDSGAFKLSKDGSLLLQFAPAAGVRQYDWSKKQVWFHPFNFR*