Gene Details:

  • Gene ID: Niben101Scf37331g00004.1
  • Gene Family: Trihelix Family
  • Description: Trihelix Family protein
  • Species: Nicotiana benthamiana
  • Source: Trihelix family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009778178.1  — PREDICTED: formin-binding protein 4
  • Refseq:  XP_016450737.1  — PREDICTED: trihelix transcription factor ASIL2-like
  • TrEMBL:  A0A1S3YFD0  — A0A1S3YFD0_TOBAC; trihelix transcription factor ASIL2-like
  • TrEMBL:  A0A1U7WHQ6  — A0A1U7WHQ6_NICSY; formin-binding protein 4
  • STRING:  XP_009778178.1  — (Nicotiana sylvestris)

Family Introduction:

  • GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.

Literature:

Sequences:

CDS Sequence:
  • >Niben101Scf37331g00004.1|Nicotiana_benthamiana|Trihelix|Niben101Scf37331g00004.1
Protein Sequence:
  • >Niben101Scf37331g00004.1|Nicotiana_benthamiana|Trihelix|Niben101Scf37331g00004.1
    MDQEISNKDDFFPRNKQQNSHVATGNNTSDRLKRDEWSEGAVSCLLEAYEAKWILRNRAKLKGQDWEDVAKHVSARGNSTKSPKTQTQCKNKIESMKKRYRSESATAADASSWPLYPRLDLLLHWEDVAKHVSARGNSTKSPKTLTQCKNKIESMKKRYRSESATAADASSWPLYPRLDLLLRGNNASAASTSLIPPPPPAVVEPPQPVTVLLPPPPAPVPPPPPPPPPMAVPIGNGGQNSNGSNGVDRAAKEDTMDAKLSDNAAISDKNAMDTNSSTPALYSDDNKSKSKNVKLRSMEKKSKNKRKRAEGWEIGESIRLLAEVIVRSEQARMETMREIERMRAEAEAKRGEMDLKRTEIIANTQLEIAKLFASITKGVDPSLRIGRS