Gene Details:

  • Gene ID: Niben101Scf17719g00009.1
  • Gene Family: Trihelix Family
  • Description: Trihelix Family protein
  • Species: Nicotiana benthamiana
  • Source: Trihelix family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009791338.1  — PREDICTED: uncharacterized protein LOC104238623 isoform X2
  • Swissprot:  Q8VZ20  — ASR3_ARATH; Trihelix transcription factor ASR3
  • TrEMBL:  A0A1U7XKC1  — A0A1U7XKC1_NICSY; uncharacterized protein LOC104238623 isoform X2
  • STRING:  XP_009791337.1  — (Nicotiana sylvestris)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.

Literature:

Sequences:

CDS Sequence:
  • >Niben101Scf17719g00009.1|Nicotiana_benthamiana|Trihelix|Niben101Scf17719g00009.1
Protein Sequence:
  • >Niben101Scf17719g00009.1|Nicotiana_benthamiana|Trihelix|Niben101Scf17719g00009.1
    MALEPLTLAFDGDSNGGRQQSVNGADDGNRAPRLPRWTRQEILVLIQGKRVAESRVRRGRTVGLELGSGSGQVEPKWASVSSYCKKHGVNRGPVQCRKRWSNLAGDFKKIKEWECGIKEESESFWVMRNDLRRERKLPGFFDKEVYEILDRGSGGEEMEAGLALALAPAAAVNEPEALFDSGRSAAADEGLFSDFEQSEAGDKDKHMPIPAPTPISGINHQKEPASHPDGGSAQEGKKRKRGVTDTDEEADSLQHQLAKALERNGLALALAPAAAVNEPEALFDSGRSAAADEGLFSDFEQSEAGDKDKHMPIPAPTPISGINHQKEPASHPDGGSAQEGKKRKRGVTDTDEEADSLQHQLAKALERNGNLLSSQLEAQNAHYQLDREQRKDHVNSLIAVLDKLADAMGRIADKL