Gene Details:
- Gene ID: Niben101Scf15049g00021.1
- Gene Family: Trihelix Family
- Description: Trihelix Family protein
- Species: Nicotiana benthamiana
- Source: Trihelix family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_009593617.1 — PREDICTED: trihelix transcription factor ASIL2
- Refseq: XP_016485756.1 — PREDICTED: trihelix transcription factor ASIL2-like
- Refseq: XP_018624331.1 — PREDICTED: trihelix transcription factor ASIL2
- TrEMBL: A0A1S4BA19 — A0A1S4BA19_TOBAC; trihelix transcription factor ASIL2-like
- STRING: XP_009593617.1 — (Nicotiana tomentosiformis)
Family Introduction:
- GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.
Literature:
- Systematic analysis of GT factor family of rice reveals a novel subfamily involved in stress responses. DOI: 10.1007/s00438-009-0507-x ; PMID: 20039179
Sequences:
CDS Sequence:
- >Niben101Scf15049g00021.1|Nicotiana_benthamiana|Trihelix|Niben101Scf15049g00021.1
Protein Sequence:
- >Niben101Scf15049g00021.1|Nicotiana_benthamiana|Trihelix|Niben101Scf15049g00021.1
MDQEISNKDDFFPRNKQQNYHVAPGNNTSDRLKRDEWSEGAGSCLLEAYEAKWILRNRAKLKGQDWEDVAKHVSARGNSTKSPKTLTQCKNKIESMKKRYRSESATAADASSWPLYPRLDLLLHWEDVAKHVSARGNSTKSPKTLTQCKNKIESMKKRYRSESATAADASSWPLYPRLDLLLRGNNASAASTSVIPPPPLAVVETPQPATVPPPPPIPVPPPPPPPPPMDVPIGNGGQNSNGSNGVDRAAKEDTMDTKLSDNAAISDKNAMDTNSSTPALYSDDKSKSKNVKLRSMEKKSKNKRKRAEGWEIGESIRLLAEVVVRSEQARMETMREIERMRAEAEAKRGEMEP