Gene Details:

  • Gene ID: Niben101Scf01697g05002.1
  • Gene Family: Trihelix Family
  • Description: Trihelix Family protein
  • Species: Nicotiana benthamiana
  • Source: Trihelix family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_009791337.1  — PREDICTED: uncharacterized protein LOC104238623 isoform X1
  • Refseq:  XP_016472490.1  — PREDICTED: trihelix transcription factor ASR3-like
  • Swissprot:  Q8VZ20  — ASR3_ARATH; Trihelix transcription factor ASR3
  • TrEMBL:  A0A1S4A785  — A0A1S4A785_TOBAC; trihelix transcription factor ASR3-like
  • TrEMBL:  A0A1U7XGZ1  — A0A1U7XGZ1_NICSY; uncharacterized protein LOC104238623 isoform X1
  • STRING:  XP_009791337.1  — (Nicotiana sylvestris)

Gene Ontology:

  • GO:0045892  — Biological Process — negative regulation of transcription, DNA-templated
  • GO:0050777  — Biological Process — negative regulation of immune response
  • GO:0071219  — Biological Process — cellular response to molecule of bacterial origin
  • GO:0005634  — Cellular Component — nucleus
  • GO:0003677  — Molecular Function — DNA binding
  • GO:0042803  — Molecular Function — protein homodimerization activity

Family Introduction:

  • GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.

Literature:

Sequences:

CDS Sequence:
  • >Niben101Scf01697g05002.1|Nicotiana_benthamiana|Trihelix|Niben101Scf01697g05002.1
Protein Sequence:
  • >Niben101Scf01697g05002.1|Nicotiana_benthamiana|Trihelix|Niben101Scf01697g05002.1
    MALEPLTLAFDGDSNDGRQQSVNGADDGNRAPRLPRWTRQEILVLIQGKRVAESRVRRGRTAGLELGSGSGQVEPKWASVSSYCKKHGVNRGPVQCRKRWSNLAGDFKKIKEWECGIKEESESFWVMRNDLRRERKLPGFFDKEVYEILDRGSGGEEMEAGLALALAPAAAVNEPEALFDSGRSAAADEGLFSDFEQSEAGDKDKHMPIPAPTPISEQQCQPLPMECHAQGINRQKEPTSNPDGGSAQEGKKRKRGVTDTDEEADNLQYQLAKALERNGNLLSSQLEAQNAHYQLDREQRKDHVKSLIAVLDKLADAMGRIADKL