Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_023904917.1  — trihelix transcription factor GT-1-like isoform X1
  • Swissprot:  Q9FX53  — TGT1_ARATH; Trihelix transcription factor GT-1
  • TrEMBL:  A0A314ZGR1  — A0A314ZGR1_PRUYE; Trihelix transcription factor GT-1-like isoform X2
  • STRING:  XP_008222025.1  — (Prunus mume)
  • STRING:  GLYMA11G37390.2  — (Glycine max)

Gene Ontology:

  • GO:0005634  — Cellular Component — nucleus
  • GO:0003700  — Molecular Function — transcription factor activity, sequence-specific DNA binding
  • GO:0042802  — Molecular Function — identical protein binding
  • GO:0043565  — Molecular Function — sequence-specific DNA binding

Family Introduction:

  • GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.

Literature:

Sequences:

CDS Sequence:
  • >maker-scaffold01594-augustus-gene-0.20-mRNA-2|Castanea_mollissima|Trihelix|maker-scaffold01594-augustus-gene-0.20-mRNA-2
Protein Sequence:
  • >maker-scaffold01594-augustus-gene-0.20-mRNA-2|Castanea_mollissima|Trihelix|maker-scaffold01594-augustus-gene-0.20-mRNA-2
    MYLSEKPRPIDLYKEEGARDMMIEVVSNGGGDLGPHHAPQPHPHAHAHSHHQHQQMILGDSSGGDEDHEVEVEVKAPKKRAETWVQDETRSLISLRREMDGLFNTSKSNKHLWEQISSKMREKGFDRSPTMCTDKWRNLLKEFKKAKHQDRGSGSAKMSYYKEIEEILRDRSKNAQYKSPTPPKVDTYMQFSDKVLFRNQDISSTLLGVGINVFVNPVLVIYGFGVLCSCIEDAGISFGPVEATGRPTLNLERRLDHDGHPLAITTADAVAASGVPPWNWRETPGNGGESQSYCGRVISVKWGDYTRRIGIDGSTDAIKEAIRCAFRLRTKRAFWLEDEDQIIRSLDRDMPLGNYMLHLDEGLAIKVCLYDESDHIPAMHTEDKIFYTEDDYRNFLSQRGWSCLRELDGYRNIDSMDDLRPGAIYRGGAIYRGES