Gene Details:

  • Gene ID: Jcr4U31786.10
  • Gene Family: Trihelix Family
  • Description: Trihelix Family protein
  • Species: Jatropha curcas
  • Source: Trihelix family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_012066442.1  — trihelix transcription factor PTL
  • Swissprot:  Q9LZS0  — PTL_ARATH; Trihelix transcription factor PTL
  • TrEMBL:  A0A067LF24  — A0A067LF24_JATCU; Uncharacterized protein
  • STRING:  cassava4.1_005544m  — (Manihot esculenta)

Family Introduction:

  • GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.

Literature:

Sequences:

CDS Sequence:
  • >Jcr4U31786.10|Jatropha_curcas|Trihelix|Jcr4U31786.10
    ATGTGCGAGGAGCATGGATATCAAAGGAGTGGAAAGAAATGCAGAGAAAAATTTGAAAACTTGTACAAATATTACAAGAAGACTAAAGAAGGTAAAGCAGGAAGACAAGATGGTAAGCACTATAGATTCTTTAGACAACTTGAAGCTCTTTATGGAGAAACAAGCAATTCTGCTTCAATCCCTGAAACTCATTTTGTTAATAATAACACTAATCTTCCATTTCACACCACTTGTACTCTTGGCTGCTTAACAACAATTTTCGTTAAACCTGTAAATGATCATCAATTCAATAACAAACAAGTTCATATTTAG
Protein Sequence:
  • >Jcr4U31786.10|Jatropha_curcas|Trihelix|Jcr4U31786.10
    MCEEHGYQRSGKKCREKFENLYKYYKKTKEGKAGRQDGKHYRFFRQLEALYGETSNSASIPETHFVNNNTNLPFHTTCTLGCLTTIFVKPVNDHQFNNKQVHI