Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_004305769.1  — PREDICTED: trihelix transcription factor ASIL2
  • Swissprot:  Q9LJG8  — ASIL2_ARATH; Trihelix transcription factor ASIL2
  • TrEMBL:  A0A2R6QFA1  — A0A2R6QFA1_ACTCH; Trihelix transcription factor
  • STRING:  XP_004305769.1  — (Fragaria vesca)

Gene Ontology:

  • GO:0009793  — Biological Process — embryo development ending in seed dormancy
  • GO:0010431  — Biological Process — seed maturation

Family Introduction:

  • GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.

Literature:

Sequences:

CDS Sequence:
  • >FANhyb_icon20430553_s.1.g00001.1|Fragaria_x_ananassa|Trihelix|FANhyb_icon20430553_s.1.g00001.1
    CGGCGGCGGGAGAGAGGACTGCTGGAGCGAGAGCGCGACGGCGGTGCTGATAGAGGCGTGGGGGGAGAGGTACTTGGAGCTGAGCAGAGGGAACCTGAAGCAGAAGCACTGGAAGGAGGTGGCGGACATTGTGAGCAGCAGAGAGGACTACGGCAAAACCCCAAAGACTGATATCCAGTGCAAGAATAGAATCGACACCGTCAAGAAGAAGTACAAGCTTGAGAAGTCCAAGATGCTCGCCGGAGCCGGCCCCAGCAAGTGGCCCTTTTTCGCCAAGCTTGATCATTTGATTGGCGCCACCGGGAAGGGGACTCCTGGCTCCGGCGGCGGTCCGGTGCCGCCGGGGTTCATGTCCAAGAACCACAAGATTCCCATGGGAATGCCGGTCGGGGTCCGCGGCGGAGGAGGAGGAGTTGGGCAGTTTGTGCCCAAGCACCTGCAGCAACTGCAG
Protein Sequence:
  • >FANhyb_icon20430553_s.1.g00001.1|Fragaria_x_ananassa|Trihelix|FANhyb_icon20430553_s.1.g00001.1
    GGGREDCWSESATAVLIEAWGERYLELSRGNLKQKHWKEVADIVSSREDYGKTPKTDIQCKNRIDTVKKKYKLEKSKMLAGAGPSKWPFFAKLDHLIGATGKGTPGSGGGPVPPGFMSKNHKIPMGMPVGVRGGGGGVGQFVPKHLQQLQ