Gene Details:

Protein Features:

Annotation Proteins:

  • Refseq:  XP_004301730.2  — PREDICTED: trihelix transcription factor ASIL2-like
  • TrEMBL:  A0A2P6P8Z0  — A0A2P6P8Z0_ROSCH; Putative transcription factor Trihelix family
  • STRING:  XP_004301730.1  — (Fragaria vesca)

Family Introduction:

  • GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.

Literature:

Sequences:

CDS Sequence:
  • >FANhyb_icon18453807_s.1.g00001.1|Fragaria_x_ananassa|Trihelix|FANhyb_icon18453807_s.1.g00001.1
    AAAGCCGCCGACTGGGACCACGTCGCCAAGACCACCGCTGCGACTTCCTCCTCCTCCTCGCCGCCGAAGACCGCGCTGCAGTGCCGCCATAAGATGGAGAAGCTTCGCAAGCGGTACCGCGCTGAGAAGCAACGCGCTTCCAACTACCCGGGTCGGTTCTTCTCGTCGTGGGCTTTGTTTCATCTTATGGATGAGATGGAGTCCGACCCGGATCGGAAACCGATTGATGAGG
Protein Sequence:
  • >FANhyb_icon18453807_s.1.g00001.1|Fragaria_x_ananassa|Trihelix|FANhyb_icon18453807_s.1.g00001.1
    KAADWDHVAKTTAATSSSSSPPKTALQCRHKMEKLRKRYRAEKQRASNYPGRFFSSWALFHLMDEMESDPDRKPIDE