Gene Details:

  • Gene ID: Csa13491s010.1
  • Gene Family: Trihelix Family
  • Description: Trihelix Family protein
  • Species: Camelina sativa
  • Source: Trihelix family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_019100416.1  — PREDICTED: trihelix transcription factor ASIL2-like
  • Refseq:  XP_019101939.1  — PREDICTED: trihelix transcription factor ASIL2-like
  • Swissprot:  Q9LJG8  — ASIL2_ARATH; Trihelix transcription factor ASIL2
  • TrEMBL:  R0FPF3  — R0FPF3_9BRAS; Uncharacterized protein
  • STRING:  XP_010504818.1  — (Camelina sativa)

Family Introduction:

  • GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.

Literature:

Sequences:

CDS Sequence:
  • >Csa13491s010.1|Camelina_sativa|Trihelix|Csa13491s010.1
    ATGATGGACTCCGTTCACGATTCCTTTTCGCCGGGATCTTCTCGTCCTTCGCCGTCGACGCTTTCTCGTGAAGATTGCTGGAGCGAGGAAGCGACCTTCACGCTCATCCAAGCCTGGGGTAATCGCTTCGTCGAGCTTAGCCGTGGTAATCTCCGTCAGAAACACTGGCAAGAGGTCGCTAACGCCGTTAACGACCGTCACTTCAACTCCGGCCGAAACGTTTCCGCCGCCAAATCGCAGCCGTATCGCACCGACGTTCAGTGTAAAAACCGGATCGATACTTTGAAGAAGAAGTACAAAGTCGAG
Protein Sequence:
  • >Csa13491s010.1|Camelina_sativa|Trihelix|Csa13491s010.1
    MMDSVHDSFSPGSSRPSPSTLSREDCWSEEATFTLIQAWGNRFVELSRGNLRQKHWQEVANAVNDRHFNSGRNVSAAKSQPYRTDVQCKNRIDTLKKKYKVE