Gene Details:

  • Gene ID: Csa02g071890.1
  • Gene Family: Trihelix Family
  • Description: Trihelix Family protein
  • Species: Camelina sativa
  • Source: Trihelix family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_019093836.1  — PREDICTED: uncharacterized protein LOC104741250 isoform X1
  • Refseq:  XP_019093840.1  — PREDICTED: uncharacterized protein LOC104741250 isoform X2
  • Swissprot:  Q84W56  — RNJ_ARATH; Ribonuclease J
  • TrEMBL:  R0G7Y9  — R0G7Y9_9BRAS; Uncharacterized protein
  • STRING:  XP_010444239.1  — (Camelina sativa)
  • STRING:  XP_010460300.1  — (Camelina sativa)

Family Introduction:

  • GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.

Literature:

Sequences:

CDS Sequence:
  • >Csa02g071890.1|Camelina_sativa|Trihelix|Csa02g071890.1
    ATGCGTGGAGAGCTGCACAGTAGATTTCAAGTGGTGAAAGGTAGAATGGCATTGTGGGAAGAGATCTCTTCAAACCTATCAGCTGAAGGGTTCGACCGAAGCCCGGGACAATGCAAGTCTCTCTGGGCGTCACTTATTCAAAAATACGAGGAGTGCAAGGCTGAGGAAAGAAGCAAGACGAGTTGGCCACATTTTGAGGATATGAACAACATTTTGTCAGAGTTAGGCACACCTACATCCTAA
Protein Sequence:
  • >Csa02g071890.1|Camelina_sativa|Trihelix|Csa02g071890.1
    MRGELHSRFQVVKGRMALWEEISSNLSAEGFDRSPGQCKSLWASLIQKYEECKAEERSKTSWPHFEDMNNILSELGTPTS*