Gene Details:

  • Gene ID: cra_locus_7483_iso_2
  • Gene Family: Trihelix Family
  • Description: Trihelix Family protein
  • Species: Catharanthus roseus
  • Source: Trihelix family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_027177086.1  — uncharacterized protein LOC113776178 isoform X2
  • TrEMBL:  A0A068V3V3  — A0A068V3V3_COFCA; Uncharacterized protein
  • STRING:  XP_009619381.1  — (Nicotiana tomentosiformis)

Gene Ontology:

  • GO:0006221  — Biological Process — pyrimidine nucleotide biosynthetic process
  • GO:0005737  — Cellular Component — cytoplasm
  • GO:0033862  — Molecular Function — UMP kinase activity

Family Introduction:

  • GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.

Literature:

Sequences:

CDS Sequence:
  • >cra_locus_7483_iso_2|Catharanthus_roseus|Trihelix|cra_locus_7483_iso_2
Protein Sequence:
  • >cra_locus_7483_iso_2|Catharanthus_roseus|Trihelix|cra_locus_7483_iso_2
    XRNYLSPNGLSPFDGFTFAISRHIQQDXRRHPLHVPDVVCPLTSPSPNPNGXPLTPPSMASCDDDFSLLGDDTTTATAATVHPPNPNPNLIHRRQSFTHRNISATGDNDVVSPDADGYSDGGFCSSQPNSKSNNNHNTPSFHVVNVNPYDADPNPFDTDPVPNKSRLNNNIHSPHDKRTDREEVSDSGTPYPYKRARASSSAGGGDYRKDREEWSDSAIACLLEAYTEKFMMLNRGNLRGRDWEEVAAMVSERCDKQSKSVEQCKNKVDNLKKRYKLERHRLTNGGVSASHWPWFKQMEQIVGNSLSTKTAATTDDDKSGGGPTSSGKQSKRYGSPAASPGGQINNVKSKATTSARWRRVVFKISGSALAGTAPQNIDPKVAMLIAREVSIACRMGVESALEKLGVQTRVQSAFSMPEVAEPYSRQRAIRHLEKGRVVIFGGIGAGTGNPLFSTDTAAALRASEIHADAVLKGTNVDGVFVCDPGNNNSVAAEHISFGEWSTIGTPPMDTMAVRFCEDNGISVVIFNIHEPGNISRALCGEQVGTLIDQTGRVG