Gene Details:
- Gene ID: cra_locus_6749_iso_1
- Gene Family: Trihelix Family
- Description: Trihelix Family protein
- Species: Catharanthus roseus
- Source: Trihelix family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_027100204.1 — trihelix transcription factor ASR3 isoform X2
- Refseq: XP_027154551.1 — trihelix transcription factor ASR3
- Swissprot: Q8VZ20 — ASR3_ARATH; Trihelix transcription factor ASR3
- TrEMBL: A0A1Q3BVU8 — A0A1Q3BVU8_CEPFO; Myb_DNA-bind_4 domain-containing protein
- STRING: Gorai.002G021600.1 — (Gossypium raimondii)
Gene Ontology:
- GO:0045892 — Biological Process — negative regulation of transcription, DNA-templated
- GO:0050777 — Biological Process — negative regulation of immune response
- GO:0071219 — Biological Process — cellular response to molecule of bacterial origin
- GO:0005634 — Cellular Component — nucleus
- GO:0003677 — Molecular Function — DNA binding
- GO:0042803 — Molecular Function — protein homodimerization activity
Family Introduction:
- GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.
Literature:
- Systematic analysis of GT factor family of rice reveals a novel subfamily involved in stress responses. DOI: 10.1007/s00438-009-0507-x ; PMID: 20039179
Sequences:
CDS Sequence:
- >cra_locus_6749_iso_1|Catharanthus_roseus|Trihelix|cra_locus_6749_iso_1
Protein Sequence:
- >cra_locus_6749_iso_1|Catharanthus_roseus|Trihelix|cra_locus_6749_iso_1
MAFEQLRLAPAAAVDDTSPAAAVNGRQLHLDVPDDAAKVPRLPRWTRQEILVLIQGKKVAENRVRRGRTAGLAFGSAQVEPKWASVSSYCKRHGVNRGPVQCRKRWSNLAGDFKKKSEGKKRKRHTVQVDEEDETRNLQDQLVEVLERNGTLLSSQLESQNIHLQLEREQRKDHVNSLISVLNKLADALGRIADKL