Gene Details:
- Gene ID: cra_locus_38068_iso_1
- Gene Family: Trihelix Family
- Description: Trihelix Family protein
- Species: Catharanthus roseus
- Source: Trihelix family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_012492854.1 — PREDICTED: trihelix transcription factor GTL2 isoform X2
- Refseq: XP_016668746.1 — PREDICTED: trihelix transcription factor GTL2-like isoform X2
- Refseq: XP_017630950.1 — PREDICTED: trihelix transcription factor GTL2
- Swissprot: Q8H181 — GTL2_ARATH; Trihelix transcription factor GTL2
- TrEMBL: A0A0B0N7D5 — A0A0B0N7D5_GOSAR; Uncharacterized protein
- TrEMBL: A0A0D2SL93 — A0A0D2SL93_GOSRA; Uncharacterized protein
- TrEMBL: A0A1U8HRX8 — A0A1U8HRX8_GOSHI; trihelix transcription factor GTL2-like isoform X2
- STRING: Gorai.007G283800.1 — (Gossypium raimondii)
Family Introduction:
- GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.
Literature:
- Systematic analysis of GT factor family of rice reveals a novel subfamily involved in stress responses. DOI: 10.1007/s00438-009-0507-x ; PMID: 20039179
Sequences:
CDS Sequence:
- >cra_locus_38068_iso_1|Catharanthus_roseus|Trihelix|cra_locus_38068_iso_1
Protein Sequence:
- >cra_locus_38068_iso_1|Catharanthus_roseus|Trihelix|cra_locus_38068_iso_1
KEKWENINKYFRKTKDSKKKRSMDSRTCPYFQQLSSLYSQGTLVGPSDEPENR