Gene Details:

  • Gene ID: cra_locus_38068_iso_1
  • Gene Family: Trihelix Family
  • Description: Trihelix Family protein
  • Species: Catharanthus roseus
  • Source: Trihelix family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_012492854.1  — PREDICTED: trihelix transcription factor GTL2 isoform X2
  • Refseq:  XP_016668746.1  — PREDICTED: trihelix transcription factor GTL2-like isoform X2
  • Refseq:  XP_017630950.1  — PREDICTED: trihelix transcription factor GTL2
  • Swissprot:  Q8H181  — GTL2_ARATH; Trihelix transcription factor GTL2
  • TrEMBL:  A0A0B0N7D5  — A0A0B0N7D5_GOSAR; Uncharacterized protein
  • TrEMBL:  A0A0D2SL93  — A0A0D2SL93_GOSRA; Uncharacterized protein
  • TrEMBL:  A0A1U8HRX8  — A0A1U8HRX8_GOSHI; trihelix transcription factor GTL2-like isoform X2
  • STRING:  Gorai.007G283800.1  — (Gossypium raimondii)

Family Introduction:

  • GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.

Literature:

Sequences:

CDS Sequence:
  • >cra_locus_38068_iso_1|Catharanthus_roseus|Trihelix|cra_locus_38068_iso_1
Protein Sequence:
  • >cra_locus_38068_iso_1|Catharanthus_roseus|Trihelix|cra_locus_38068_iso_1
    KEKWENINKYFRKTKDSKKKRSMDSRTCPYFQQLSSLYSQGTLVGPSDEPENR