Gene Details:
- Gene ID: cra_locus_12127_iso_3
- Gene Family: Trihelix Family
- Description: Trihelix Family protein
- Species: Catharanthus roseus
- Source: Trihelix family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_027105528.1 — trihelix transcription factor ASIL2-like
- TrEMBL: A0A068TLE8 — A0A068TLE8_COFCA; Uncharacterized protein
- STRING: XP_009757835.1 — (Nicotiana sylvestris)
Family Introduction:
- GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.
Literature:
- Systematic analysis of GT factor family of rice reveals a novel subfamily involved in stress responses. DOI: 10.1007/s00438-009-0507-x ; PMID: 20039179
Sequences:
CDS Sequence:
- >cra_locus_12127_iso_3|Catharanthus_roseus|Trihelix|cra_locus_12127_iso_3
Protein Sequence:
- >cra_locus_12127_iso_3|Catharanthus_roseus|Trihelix|cra_locus_12127_iso_3
MGEIHESSATQSQTPPTRPLPFREDCWSEEATSTLVDAWGRRYLELNRGNLRQKDWQEVADGVNARHGHTKKTRRTDVQCKNRIDTLKKKYKIEKAKIAESNGNLTSSWPFYTRLDALIGPNVKNQSQKLMPLMNSSAQSQLSMPLPPMGIPLYKKPQLLLPPAVPLEPVVLPQKRQFSSVGDSYFRKNYSAMAAAAAAAEEDVEEDEDGEAGSDEEEEDDVEEKDGTAEEEGMRRLAKAIERFGGIYERVENMKQRQMVELEKQRMQFTKDLEVQRMQLFMDTQVQLEKLKQAKRSGSDDIYS