Gene Details:
- Gene ID: CA04g06740
- Gene Family: Trihelix Family
- Description: Trihelix Family protein
- Species: Capsicum annuum
- Source: Trihelix family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_016569813.1 — PREDICTED: trihelix transcription factor GT-4-like isoform X1
- Refseq: XP_016569815.1 — PREDICTED: trihelix transcription factor GT-1-like isoform X2
- Swissprot: Q9LU92 — TGT4_ARATH; Trihelix transcription factor GT-4
- TrEMBL: A0A1U8GFB9 — A0A1U8GFB9_CAPAN; trihelix transcription factor GT-1-like isoform X2
- TrEMBL: A0A2G2WYF4 — A0A2G2WYF4_CAPBA; Uncharacterized protein
- TrEMBL: A0A2G3CMH9 — A0A2G3CMH9_CAPCH; Trihelix transcription factor GT-1
- STRING: Solyc12g077540.1.1 — (Solanum lycopersicum)
Gene Ontology:
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.
Literature:
- Systematic analysis of GT factor family of rice reveals a novel subfamily involved in stress responses. DOI: 10.1007/s00438-009-0507-x ; PMID: 20039179
Sequences:
CDS Sequence:
- >CA04g06740|Capsicum_annuum|Trihelix|CA04g06740
ATGATCGTTGACGTCGTCACTGGCAATACCCAACTTCCACCTGGCCATCAAATCGGAGATACGACTAGCAGTGGCGGGGAGGAGAATTGTGCAAACCCTTGTTCTGATCTGAAAACCCCTAAGAAACGAGCAGAGACATGGGTACAAGAAGAAACTCGAGTACTTATTGGTCTTCGCCGAGAAATCGACTCACTTTTCAATACTTCAAAGTCCAATAAGCATTTGTGGGACCAGATTTCTATGAAGATGAGAGAAAAAGGGTTTGATAGGTCACCTACTATGTGTACTGATAAGTGGAGAAATTTGTTGAAGGAATTCAAGAAAGCTAAACAAAATCAAGATAGAAATGGTTCTGCTAAGATGTCCTATTATAAAGAAATTGAGGAGATTTTGAGAGAGAGGATTAATAGTGGCGGTGGTTATAAGAGTCCTCCAGCTCCCAAGGTTGATTCTTTTATGCACTTCGCGGAAAAGGGT
Protein Sequence:
- >CA04g06740|Capsicum_annuum|Trihelix|CA04g06740
MIVDVVTGNTQLPPGHQIGDTTSSGGEENCANPCSDLKTPKKRAETWVQEETRVLIGLRREIDSLFNTSKSNKHLWDQISMKMREKGFDRSPTMCTDKWRNLLKEFKKAKQNQDRNGSAKMSYYKEIEEILRERINSGGGYKSPPAPKVDSFMHFAEKG