Gene Details:
- Gene ID: Araha.36284s0002.1.p
- Gene Family: Trihelix Family
- Description: Trihelix Family protein
- Species: Arabidopsis halleri
- Source: Trihelix family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_020868150.1 — trihelix transcription factor GTL1 isoform X1
- Swissprot: Q9C882 — GTL1_ARATH; Trihelix transcription factor GTL1
- TrEMBL: D7KIG8 — D7KIG8_ARALL; Uncharacterized protein
- STRING: fgenesh2_kg.1__3451__AT1G33240.1 — (Arabidopsis lyrata)
Gene Ontology:
- GO:0008361 — Biological Process — regulation of cell size
- GO:0010090 — Biological Process — trichome morphogenesis
- GO:0030308 — Biological Process — negative regulation of cell growth
- GO:0032876 — Biological Process — negative regulation of DNA endoreduplication
- GO:0042631 — Biological Process — cellular response to water deprivation
- GO:0045892 — Biological Process — negative regulation of transcription, DNA-templated
- GO:2000037 — Biological Process — regulation of stomatal complex patterning
- GO:2000038 — Biological Process — regulation of stomatal complex development
- GO:0005634 — Cellular Component — nucleus
- GO:0043565 — Molecular Function — sequence-specific DNA binding
Family Introduction:
- GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.
Literature:
- Systematic analysis of GT factor family of rice reveals a novel subfamily involved in stress responses. DOI: 10.1007/s00438-009-0507-x ; PMID: 20039179
Sequences:
CDS Sequence:
- >Araha.36284s0002.1.p|Arabidopsis_halleri|Trihelix|Araha.36284s0002.1.p
ATGGTCATGAGCTCGGAACAATCATCATTACCATCATCATCAAGATGGCCAAAGGCGGAGATTCTAGCGCTTATAAACCTAAGAAGCGGAATGGAACCAAGGTATCAAGATAATGTCCCTAAAGGACTTCTATGGGAAGAGATCTCAACTTCAATGAAGAGAATGGGATACAACAGAAACGCTAAGAGATGTAAAGAGAAATGGGAAAACATAAACAAATACTACAAGAAAGTTAAAGAAAGCAACAAGAAACGTCCTCAAGATGCTAAGACTTGTCCTTACTTTCACCGTCTTGATCTTCTTTACCGCAACAAAGTACTCGGTAGTGGTGGCGGTTCTAGCACTTCTGGTCTACCTCAAGACCAAAAGCAGAGTCCAGTCCCTGCGATGAAACTGCCACAAGAAGGACTTGTTAATGTTCAACAACCTCATGGGTCAGCTTCAAGTGAGGAAGAGGAGCCTATAGAGGAAAGTCCACAAGGAACAGAAAAGCCAGAAGACCTTGTGATGAGAGAGCTGATGCAACAACAACAAGAAGATTCAATGATAGGTGAGTATGAAAAGATTGAAGAGTCTCACAATTATAATAACATGGAGGAAGAGGAAGAGGAGATGGATGTAGAAGAACTAGACGAGGATGAGAAATCCGCGGCTTTCGAGATCGCGTTTCAAAGCCCTGCAAACAGAGGAGGCAATGGCCACACGGAACCACCTTTCTTGACAATGGTTCAGTAA
Protein Sequence:
- >Araha.36284s0002.1.p|Arabidopsis_halleri|Trihelix|Araha.36284s0002.1.p
MVMSSEQSSLPSSSRWPKAEILALINLRSGMEPRYQDNVPKGLLWEEISTSMKRMGYNRNAKRCKEKWENINKYYKKVKESNKKRPQDAKTCPYFHRLDLLYRNKVLGSGGGSSTSGLPQDQKQSPVPAMKLPQEGLVNVQQPHGSASSEEEEPIEESPQGTEKPEDLVMRELMQQQQEDSMIGEYEKIEESHNYNNMEEEEEEMDVEELDEDEKSAAFEIAFQSPANRGGNGHTEPPFLTMVQ*