Gene Details:

  • Gene ID: Ahy003312
  • Gene Family: Trihelix Family
  • Description: Trihelix Family protein
  • Species: Arachis hypogaea
  • Source: Trihelix family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_015965940.1  — uncharacterized protein LOC107489683 isoform X3
  • Refseq:  XP_025703367.1  — ribonuclease J isoform X2
  • Swissprot:  Q84W56  — RNJ_ARATH; Ribonuclease J
  • TrEMBL:  A0A445EQY8  — A0A445EQY8_ARAHY; Uncharacterized protein
  • STRING:  XP_007155530.1  — (Phaseolus vulgaris)

Gene Ontology:

  • GO:0003677  — Molecular Function — DNA binding

Family Introduction:

  • GT factors constitute a plant-specific transcription factor family with a DNA-binding domain that binds GT elements. The DNA-binding domain of GT factor, rich in basic and acidic amino acids and proline and glutamine residues, features a typical trihelix (helix-loop-helix-loop-helix) structure that determines the specific binding of GT elements; thus GT factors are also called trihelix transcription factors. GT elements are highly degenerate cis-elements with A/T-rich core sequences (Villain et al. 1996; Wang et al. 2004). Interaction between GT factors and GT elements has been implicated in the complex transcriptional regulation of many plant genes.

Literature:

Sequences:

CDS Sequence:
  • >Ahy003312|Arachis_hypogaea|Trihelix|gnl|UG|Ahy#S54165803;PUT-171a-Arachis_hypogaea-13464
    ATGGCCCTTTGGGAAGAAGTATCTCAGAACTTGTCGGCAAATGGGATCAGCAGAAGTCCTGGGCAGTGCAAATCTCTATGGACATCTTTGTTACAGAAATATGAGGAGGTCAAGAATGAGAAGAATACCAAGAAAAAGTGGTCATATCTTGAGGACATGGAGAGGATTCTATCTGAAAATGAGGAACTGGCAACAAAATGA
Protein Sequence:
  • >Ahy003312|Arachis_hypogaea|Trihelix|gnl|UG|Ahy#S54165803;PUT-171a-Arachis_hypogaea-13464
    MALWEEVSQNLSANGISRSPGQCKSLWTSLLQKYEEVKNEKNTKKKWSYLEDMERILSENEELATK