Gene Details:

  • Gene ID: Spipo2G0079100
  • Gene Family: SAP Family
  • Description: SAP Family protein
  • Species: Spirodela polyrhiza
  • Source: SAP family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_010270208.1  — PREDICTED: transcriptional regulator STERILE APETALA
  • TrEMBL:  A0A438IFN3  — A0A438IFN3_VITVI; Transcriptional regulator STERILE APETALA
  • TrEMBL:  F6HHP0  — F6HHP0_VITVI; Uncharacterized protein
  • STRING:  VIT_12s0057g00910.t01  — (Vitis vinifera)
  • STRING:  XP_010270208.1  — (Nelumbo nucifera)

Family Introduction:

  • A recessive mutation in the Arabidopsis STERILE APETALA (SAP) causes severe aberrations in inflorescence and flower and ovule development. In sap flowers, sepals are carpelloid, petals are short and narrow or absent, and anthers are degenerated. Megasporogenesis, the process of meiotic divisions preceding the female gametophyte formation, is arrested in sap ovules during or just after the first meiotic division. More severe aberrations were observed in double mutants between sap and mutant alleles of the floral homeotic gene APETALA2 (AP2) suggesting that both genes are involved in the initiation of female gametophyte development. Together with the organ identity gene AGAMOUS (AG) SAP is required for the maintenance of floral identity acting in a manner similar to APETALA1. In contrast to the outer two floral organs in sap mutant flowers, normal sepals and petals develop in ag/sap double mutants, indicating that SAP negatively regulates AG expression in the perianth whorls. This supposed cadastral function of SAP is supported by in situ hybridization experiments showing ectopic expression of AG in the sap mutant. We have cloned the SAP gene by transposon tagging and revealed that it encodes a novel protein with sequence motifs, that are also present in plant and animal transcription regulators. Consistent with the mutant phenotype, SAP is expressed in inflorescence and floral meristems, floral organ primordia, and ovules. Taken together, we propose that SAP belongs to a new class of transcription regulators essential for a number of processes in Arabidopsis flower development.

Literature:

Sequences:

CDS Sequence:
  • >Spipo2G0079100|Spirodela_polyrhiza|SAP|Spipo2G0079100
    ATGTCGCTGGCGGATCCTCGGACCGGCGAGCCGTCGTCGTCACGGCGGAGGTCCGGGGACGGGGTCTGGCCGGAGCCGTTCGTGGAGGCGCTGGCGGTGCAGGTGGCGATCGACGCCGGCAAAACAGGAGGGAGGCTCTCCGTTGCTCCAGCCGTCGTCGCCGTCTTCCAGGTATCGCTCCTCCGTGGCCTCGACTGCCGGCTGCCTTTCCCTCTCCCCTCCGTCATCTTAATCCGGAGTCGTAGTATTTATCTCTGA
Protein Sequence:
  • >Spipo2G0079100|Spirodela_polyrhiza|SAP|Spipo2G0079100
    MSLADPRTGEPSSSRRRSGDGVWPEPFVEALAVQVAIDAGKTGGRLSVAPAVVAVFQVSLLRGLDCRLPFPLPSVILIRSRSIYL*