Information report for Achn384981
Gene Details
|
|
Functional Annotation
- Refseq: XP_028093942.1 — transcriptional regulator STERILE APETALA
- Swissprot: Q9FKH1 — SAP_ARATH; Transcriptional regulator STERILE APETALA
- TrEMBL: A0A2R6PUK2 — A0A2R6PUK2_ACTCH; Transcriptional regulator STERILE APETALA like
- STRING: XP_009596786.1 — (Nicotiana tomentosiformis)
- GO:0005515 — Molecular Function — protein binding
Family Introduction
- A recessive mutation in the Arabidopsis STERILE APETALA (SAP) causes severe aberrations in inflorescence and flower and ovule development. In sap flowers, sepals are carpelloid, petals are short and narrow or absent, and anthers are degenerated. Megasporogenesis, the process of meiotic divisions preceding the female gametophyte formation, is arrested in sap ovules during or just after the first meiotic division. More severe aberrations were observed in double mutants between sap and mutant alleles of the floral homeotic gene APETALA2 (AP2) suggesting that both genes are involved in the initiation of female gametophyte development. Together with the organ identity gene AGAMOUS (AG) SAP is required for the maintenance of floral identity acting in a manner similar to APETALA1. In contrast to the outer two floral organs in sap mutant flowers, normal sepals and petals develop in ag/sap double mutants, indicating that SAP negatively regulates AG expression in the perianth whorls. This supposed cadastral function of SAP is supported by in situ hybridization experiments showing ectopic expression of AG in the sap mutant. We have cloned the SAP gene by transposon tagging and revealed that it encodes a novel protein with sequence motifs, that are also present in plant and animal transcription regulators. Consistent with the mutant phenotype, SAP is expressed in inflorescence and floral meristems, floral organ primordia, and ovules. Taken together, we propose that SAP belongs to a new class of transcription regulators essential for a number of processes in Arabidopsis flower development.
Literature and News
Gene Resources
- Gene3D: G3DSA:1.20.1280.50
- SuperFamily: SSF50978
- Gene3D: G3DSA:2.130.10.10
- PROSITE pattern: PS00678
- InterPro: IPR017986 IPR015943 IPR019775
Homologs
- Capsicum annuum: CA07g09520
- Daucus carota: DCAR_019686
- Fragaria vesca: mrna15603.1-v1.0-hybrid
- Malus domestica: MDP0000149352
- Nicotiana benthamiana: Niben101Scf02647g03011.1, Niben101Scf05960g00004.1
- Nicotiana tabacum: XP_016468216.1, XP_016511484.1, XP_016484858.1
- Petunia inflata: Peinf101Scf03171g00023.1, Peinf101Scf00131g14005.1
- Salvia miltiorrhiza: SMil_00010968-RA_Salv
- Solanum lycopersicum: Solyc05g041220.1.1
- Solanum melongena: Sme2.5_03121.1_g00005.1
- Solanum tuberosum: PGSC0003DMP400032838
- Vitis vinifera: GSVIVT01030075001
Sequences
CDS Sequence:
- >Achn384981|Actinidia_chinensis|SAP|Achn384981
ATGTATTATCAAGATATCCTTAATCCCCTTCTCTTTGACATCCCATCATCAAGGAGAATAAAAAGGAGAAACGGCTCTCAGGGAATACGTATTGTATTGGAAGATCAGAAACCCAGATATAGATCGTTCTCATGTATCAAGACCCTCACCCGCCAGGTCTGGAACCGCCACCACCTCCTCCACAACACGTGGCGCGACGAGTACATATTCCGCCACCGCACCGCCCGCAACTTCCTCACCCGCCGCTACGCCTACGCCACCCTTCCCTTCAACGTCTCCCCCGACCATGACGACAATGCCGCCGCCCTCTCATGCCGCCGGCTCGCACTTTCCGACCACCACCTCGCCGCCGGCTATTCTGACGGCTCAGTCCGCCTTTTCCACCTACCGTTGGGGATTCACCTCTATACCTTCCGCCCCCACCCCCGGGACTGCCTGGGACTTTTCTCGCGCGCCGTCTCTGGGATTGTTCTGTCGGACACGAGCCTCGTGTTTGCGTCCCAACATGGTGATATCCATGTTGCGCTGACGAACAATGCGGCGCCAGTGCGGAGGAGCCACCTGGGTGATGCGGTCAGTGATGGTGTTTTGGTTGACTTTTGCGGTTGTAATCGTTGGTGGGTTGGCCTCTACGCAGGTGGTCCAGGCCGTGCCTTTCAGGTGAGAGACGCCCACACCGAAGAGCTCATTTTCGTTGGCGGTGGGCTCACAGACCCCGATGCCGTCAATGGCTGGCACCTACTCAACGACTTAACTGAGTTTGTCGGCCGAGTCCGAGTCACGAGTGAAGAATCGGCCGTGGCCTGCACCCGTGTCCGAGTCATCGTCCTCGACCTCGCAAACCCAGGCTTCGTGCTCGGCCAGCAGGAGATCCAGCGAGGACTCATAGTCGGCTCCGTGGACGCTCGCGATTCGGCGTTTGTCACCGTCGACGGTCGCGGAATCGCTCGCGTGCGCCGTGCAAACACGTTAGAGGAACTATGTGGTTTCCACGTGAGGGGCGTATCGCGCGCGCAGAGGAGGGTGTTGGGGTGCATGAACACAGGGTACGCGCTAATGTGCGCCGGTGGTGTAATTAGGGCATGGGAGATTGATCATGGTGGGTATCTTTACAGGCTTAGAGAGAGAATTGGAGATGCCACGGCCTTTGTCGCGGATGACAGGTACGTGGCCGCTTCCACGAGTGACAATTCCGTACACCTATGGAACTTTGGTGTACAGTAG
Protein Sequence:
- >Achn384981|Actinidia_chinensis|SAP|Achn384981
MYYQDILNPLLFDIPSSRRIKRRNGSQGIRIVLEDQKPRYRSFSCIKTLTRQVWNRHHLLHNTWRDEYIFRHRTARNFLTRRYAYATLPFNVSPDHDDNAAALSCRRLALSDHHLAAGYSDGSVRLFHLPLGIHLYTFRPHPRDCLGLFSRAVSGIVLSDTSLVFASQHGDIHVALTNNAAPVRRSHLGDAVSDGVLVDFCGCNRWWVGLYAGGPGRAFQVRDAHTEELIFVGGGLTDPDAVNGWHLLNDLTEFVGRVRVTSEESAVACTRVRVIVLDLANPGFVLGQQEIQRGLIVGSVDARDSAFVTVDGRGIARVRRANTLEELCGFHVRGVSRAQRRVLGCMNTGYALMCAGGVIRAWEIDHGGYLYRLRERIGDATAFVADDRYVAASTSDNSVHLWNFGVQ*