Gene Details:
- Gene ID: PGSC0003DMP400003167
- Gene Name: LOC102588755
- Gene Family: S1Fa-like Family
- Description: S1Fa-like Family protein
- Species: Solanum tuberosum
- Source: S1Fa-like family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_006361797.1 — PREDICTED: DNA-binding protein S1FA-like
- Swissprot: Q42337 — S1FA2_ARATH; DNA-binding protein S1FA2
- TrEMBL: M0ZNG1 — M0ZNG1_SOLTU; Uncharacterized protein
- STRING: PGSC0003DMT400004441 — (Solanum tuberosum)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0016021 — Cellular Component — integral component of membrane
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- A cDNA encoding a specific binding activity for the tissue-specific negative cis-element S1F binding site of spinach rps1 was isolated from a spinach cDNA expression library. This cDNA of 0.7 kb encodes an unusual small peptide of only 70 amino acids, with a basic domain which contains a nuclear localization signal and a putative DNA binding helix. This protein, named S1Fa, is highly conserved between dicotyledonous and monocotyledonous plants and may represent a novel class of DNA binding proteins. The corresponding mRNA is accumulated more in roots and in etiolated seedlings than in green leaves. This expression pattern is correlated with the tissue-specific function of the S1F binding site which represses the rps1 promoter preferentially in roots and in etiolated plants.
Literature:
- Molecular cloning of a small DNA binding protein with specificity for a tissue-specific negative element within the rps1 promoter. DOI: 10.1093/nar/23.7.1165 ; PMID: 7739894
Sequences:
CDS Sequence:
- >PGSC0003DMP400003167|Solanum_tuberosum|S1Fa-like|PGSC0003DMP400003167
ATGGATTTCGAAAATCATGATAACGTGAAGAATATGGCTAAGGATGTTGAAGTGAAAGGATTCAACCCAGGATTAATTGTCTTAATAGTTGTCGGTGGGCTTCTGTTGACATTCCTCATTGGGAACTACTTGCTTTACATGTATGCACAGAAAACCCTTCCTCCAAAGAAAAAGAAGCCAGTTTCCAAGAAGAAGATGAAGAAGGAAAGACTGAAGCAAGGTGTTTCCGCACCTGGAGAATAG
Protein Sequence:
- >PGSC0003DMP400003167|Solanum_tuberosum|S1Fa-like|PGSC0003DMP400003167
MDFENHDNVKNMAKDVEVKGFNPGLIVLIVVGGLLLTFLIGNYLLYMYAQKTLPPKKKKPVSKKKMKKERLKQGVSAPGE*