Gene Details:
- Gene ID: OB04G18780.1
- Gene Name: LOC102721827
- Gene Family: S1Fa-like Family
- Description: S1Fa-like Family protein
- Species: Oryza brachyantha
- Source: S1Fa-like family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_006652250.1 — PREDICTED: DNA-binding protein S1FA2
- Swissprot: Q7XLX6 — S1FA2_ORYSJ; DNA-binding protein S1FA2
- TrEMBL: J3LXK3 — J3LXK3_ORYBR; Uncharacterized protein
- STRING: OB04G18780.1 — (Oryza brachyantha)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0016021 — Cellular Component — integral component of membrane
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- A cDNA encoding a specific binding activity for the tissue-specific negative cis-element S1F binding site of spinach rps1 was isolated from a spinach cDNA expression library. This cDNA of 0.7 kb encodes an unusual small peptide of only 70 amino acids, with a basic domain which contains a nuclear localization signal and a putative DNA binding helix. This protein, named S1Fa, is highly conserved between dicotyledonous and monocotyledonous plants and may represent a novel class of DNA binding proteins. The corresponding mRNA is accumulated more in roots and in etiolated seedlings than in green leaves. This expression pattern is correlated with the tissue-specific function of the S1F binding site which represses the rps1 promoter preferentially in roots and in etiolated plants.
Literature:
- Molecular cloning of a small DNA binding protein with specificity for a tissue-specific negative element within the rps1 promoter. DOI: 10.1093/nar/23.7.1165 ; PMID: 7739894
Sequences:
CDS Sequence:
- >OB04G18780.1|Oryza_brachyantha|S1Fa-like|OB04G18780.1
ATGGCGGATCAGTTCACGGACTCAGCGAACAATGTAATCATCGAGGAGGTCAACAAGGGCCTCAACCCTGGAACGATAGTCCTGCTTGTGGTTGCAACACTCCTGCTTCTTTTCTTTGTTGGAAACTATGCTCTCTACATGTATGCTCAGAAGACGCTTCCTCCTCGGAAGAAGAAGCCGGTCTCCAAGAAGAAGCTGAAGAGGGAAAAGCTGAAGCAGGGAGTTTCTGCACCCGGAGAGTGA
Protein Sequence:
- >OB04G18780.1|Oryza_brachyantha|S1Fa-like|OB04G18780.1
MADQFTDSANNVIIEEVNKGLNPGTIVLLVVATLLLLFFVGNYALYMYAQKTLPPRKKKPVSKKKLKREKLKQGVSAPGE