Gene Details:
- Gene ID: KHN09485.1
- Gene Family: S1Fa-like Family
- Description: S1Fa-like Family protein
- Species: Glycine soja
- Source: S1Fa-like family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_003521381.1 — DNA-binding protein S1FA
- Refseq: XP_028225807.1 — DNA-binding protein S1FA-like
- Swissprot: Q7XLX6 — S1FA2_ORYSJ; DNA-binding protein S1FA2
- TrEMBL: A0A445LDF5 — A0A445LDF5_GLYSO; DNA-binding protein S1FA2
- TrEMBL: C6SX22 — C6SX22_SOYBN; Uncharacterized protein
- STRING: GLYMA03G33640.1 — (Glycine max)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0016021 — Cellular Component — integral component of membrane
- GO:0003677 — Molecular Function — DNA binding
Family Introduction:
- A cDNA encoding a specific binding activity for the tissue-specific negative cis-element S1F binding site of spinach rps1 was isolated from a spinach cDNA expression library. This cDNA of 0.7 kb encodes an unusual small peptide of only 70 amino acids, with a basic domain which contains a nuclear localization signal and a putative DNA binding helix. This protein, named S1Fa, is highly conserved between dicotyledonous and monocotyledonous plants and may represent a novel class of DNA binding proteins. The corresponding mRNA is accumulated more in roots and in etiolated seedlings than in green leaves. This expression pattern is correlated with the tissue-specific function of the S1F binding site which represses the rps1 promoter preferentially in roots and in etiolated plants.
Literature:
- Molecular cloning of a small DNA binding protein with specificity for a tissue-specific negative element within the rps1 promoter. DOI: 10.1093/nar/23.7.1165 ; PMID: 7739894
Sequences:
CDS Sequence:
- >KHN09485.1|Glycine_soja|S1Fa-like|KHN09485.1
ATGGCCGATGACTTCGACTTCGCGGATAAAGTTCCTCCTTCATTCGATCGCGTGGGAAATGTGATCAAGGATTCTGGATCCAAAGGGTTCAATCCAGGATTAATTGTCCTCCTGGTTGTTGGTGGATTGTTGTTGACATTCCTCATTGGAAATTATGTGCTCTACAGTTATGCACAGAAGACCCTCCCTCCTAGAAAAAAGAAGCCTGTTTCAAAGAAGAAGATGAAAAAGGAGAGACTGAAGCAAGGTGTCTCTGCACCTGGAGAGTAG
Protein Sequence:
- >KHN09485.1|Glycine_soja|S1Fa-like|KHN09485.1
MADDFDFADKVPPSFDRVGNVIKDSGSKGFNPGLIVLLVVGGLLLTFLIGNYVLYSYAQKTLPPRKKKPVSKKKMKKERLKQGVSAPGE