Gene Details:

  • Gene ID: Lj0g3v0072869.2
  • Gene Family: NZZ/SPL Family
  • Description: NZZ/SPL Family protein
  • Species: Lotus japonicus
  • Source: NZZ-SPL family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_027342643.1  — uncharacterized protein LOC113855272
  • TrEMBL:  A0A445HU39  — A0A445HU39_GLYSO; Uncharacterized protein
  • TrEMBL:  K7LWF8  — K7LWF8_SOYBN; SPOROCYTELESS-like EAR-containing protein
  • STRING:  GLYMA12G35701.1  — (Glycine max)

Family Introduction:

  • The ‘floral organ-building’ gene SPOROCYTELESS/NOZZLE (SPL/NZZ) plays a central role in regulating anther cell differentiation. However, much less is known about how ‘floral organ identity’ and floral organ-building genes interact to control floral organ development. In this study, we report that ectopic expression of SPL/NZZ not only affects flower development in the wild-type background but also leads to the transformation of petal-like organs into stamen-like organs in flowers of ap2-1, a weak ap2 mutant allele. Moreover, our loss-of-function analysis indicates that the spl/nzz mutant enhances the phenotype of the ag weak allele ag-4. Furthermore, ectopic expression and overexpression of SPL/NZZ altered expression of AG, SEP3, and AP2 in rosette leaves and flowers, while ectopic expression of SPL/NZZ resulted in ectopic expression of AG and SEP3 in the outer whorls of flowers. Our results indicate that the SPL/NZZ gene is engaged in controlling stamen identity via interacting with genes required for stamen identity in Arabidopsis.

Literature:

Sequences:

CDS Sequence:
  • >Lj0g3v0072869.2|Lotus_japonicus|NZZ/SPL|Lj0g3v0072869.2
    ATGGAAGAGGATCAAGAGGACATTCCCCGAAGCTATAGCAATGGTGGTGGCAGTGGCGGCGGTGGCGGCAACAATGGAAGATCATTGAAAAAGGCAAAGCAGAGAAAGGTTCCACAGAGAGGACTTGGCGTGGCACAGCTAGAAAAGATAAGACTCGAAGAACAGGAAAAGAGAGATGTCAATGGCACTCCAATTTCATCATCATCATCCTCCACCAAATCCTCTTATCTGAATAATTTTCATCATTCTTCTTCCACCACCACCACCCCTTTACCTACTAGACCACCGCC
Protein Sequence:
  • >Lj0g3v0072869.2|Lotus_japonicus|NZZ/SPL|Lj0g3v0072869.2
    MEEDQEDIPRSYSNGGGSGGGGGNNGRSLKKAKQRKVPQRGLGVAQLEKIRLEEQEKRDVNGTPISSSSSSTKSSYLNNFHHSSSTTTTPLPTRPP