Gene Details:
- Gene ID: Lj0g3v0072869.1
- Gene Family: NZZ/SPL Family
- Description: NZZ/SPL Family protein
- Species: Lotus japonicus
- Source: NZZ-SPL family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_027342643.1 — uncharacterized protein LOC113855272
- TrEMBL: A0A445HU39 — A0A445HU39_GLYSO; Uncharacterized protein
- TrEMBL: K7LWF8 — K7LWF8_SOYBN; SPOROCYTELESS-like EAR-containing protein
- STRING: GLYMA12G35701.1 — (Glycine max)
Family Introduction:
- The ‘floral organ-building’ gene SPOROCYTELESS/NOZZLE (SPL/NZZ) plays a central role in regulating anther cell differentiation. However, much less is known about how ‘floral organ identity’ and floral organ-building genes interact to control floral organ development. In this study, we report that ectopic expression of SPL/NZZ not only affects flower development in the wild-type background but also leads to the transformation of petal-like organs into stamen-like organs in flowers of ap2-1, a weak ap2 mutant allele. Moreover, our loss-of-function analysis indicates that the spl/nzz mutant enhances the phenotype of the ag weak allele ag-4. Furthermore, ectopic expression and overexpression of SPL/NZZ altered expression of AG, SEP3, and AP2 in rosette leaves and flowers, while ectopic expression of SPL/NZZ resulted in ectopic expression of AG and SEP3 in the outer whorls of flowers. Our results indicate that the SPL/NZZ gene is engaged in controlling stamen identity via interacting with genes required for stamen identity in Arabidopsis.
Literature:
- The SPOROCYTELESS/NOZZLE gene is involved in controlling stamen identity in Arabidopsis. DOI: 10.1104/pp.109.145896 ; PMID: 19726570
Sequences:
CDS Sequence:
- >Lj0g3v0072869.1|Lotus_japonicus|NZZ/SPL|Lj0g3v0072869.1
ATGGAAGAGGATCAAGAGGACATTCCCCGAAGCTATAGCAATGGTGGTGGCAGTGGCGGCGGTGGCGGCAACAATGGAAGATCATTGAAAAAGGCAAAGCAGAGAAAGGTTCCACAGAGAGGACTTGGCGTGGCACAGCTAGAAAAGATAAGACTCGAAGAACAGGAAAAGAGAGATGTCAATGGCACTCCAATTTCATCATCATCATCCTCCACCAAATCCTCTTATCTGAATAATTTTCATCATTCTTCTTCCACCACCACCACCCCTTTACCTACTAGACCACCGCC
Protein Sequence:
- >Lj0g3v0072869.1|Lotus_japonicus|NZZ/SPL|Lj0g3v0072869.1
MEEDQEDIPRSYSNGGGSGGGGGNNGRSLKKAKQRKVPQRGLGVAQLEKIRLEEQEKRDVNGTPISSSSSSTKSSYLNNFHHSSSTTTTPLPTRPP