Gene Details:

  • Gene ID: EcC007297.50
  • Gene Family: NZZ/SPL Family
  • Description: NZZ/SPL Family protein
  • Species: Eucalyptus camaldulensis
  • Source: NZZ-SPL family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_018722516.1  — PREDICTED: uncharacterized protein LOC108956893 isoform X1
  • Refseq:  XP_018722517.1  — PREDICTED: uncharacterized protein LOC108956893 isoform X1
  • Refseq:  XP_018722518.1  — PREDICTED: uncharacterized protein LOC108956893 isoform X2
  • TrEMBL:  A0A164ZSM3  — A0A164ZSM3_DAUCS; Uncharacterized protein

Gene Ontology:

  • GO:0007264  — Biological Process — small GTPase mediated signal transduction
  • GO:0015031  — Biological Process — protein transport
  • GO:0016020  — Cellular Component — membrane
  • GO:0003676  — Molecular Function — nucleic acid binding
  • GO:0005509  — Molecular Function — calcium ion binding
  • GO:0005515  — Molecular Function — protein binding
  • GO:0005525  — Molecular Function — GTP binding

Family Introduction:

  • The ‘floral organ-building’ gene SPOROCYTELESS/NOZZLE (SPL/NZZ) plays a central role in regulating anther cell differentiation. However, much less is known about how ‘floral organ identity’ and floral organ-building genes interact to control floral organ development. In this study, we report that ectopic expression of SPL/NZZ not only affects flower development in the wild-type background but also leads to the transformation of petal-like organs into stamen-like organs in flowers of ap2-1, a weak ap2 mutant allele. Moreover, our loss-of-function analysis indicates that the spl/nzz mutant enhances the phenotype of the ag weak allele ag-4. Furthermore, ectopic expression and overexpression of SPL/NZZ altered expression of AG, SEP3, and AP2 in rosette leaves and flowers, while ectopic expression of SPL/NZZ resulted in ectopic expression of AG and SEP3 in the outer whorls of flowers. Our results indicate that the SPL/NZZ gene is engaged in controlling stamen identity via interacting with genes required for stamen identity in Arabidopsis.

Literature:

Sequences:

CDS Sequence:
  • >EcC007297.50|Eucalyptus_camaldulensis|NZZ/SPL|EcC007297.50
    ATGGGACAAGAAGAGAAAAATCCAAAGCGTAGCATCAGTAGTTATGGTGGCGTCAGAACAAGATCTTCCAAAAAGCAGAAGCAAAAGAAAGTGCCACAGCGAGGACTTGGAGTGGCACGGTTGGAGAAGATCAGGATTGAAGAACAACAGAAGAGCCATGCAACTGTTGCTGCAGTTTCAACTTTAACACCTCCACAAGATTCAGATCCTGATGTGTCA
Protein Sequence:
  • >EcC007297.50|Eucalyptus_camaldulensis|NZZ/SPL|EcC007297.50
    MGQEEKNPKRSISSYGGVRTRSSKKQKQKKVPQRGLGVARLEKIRIEEQQKSHATVAAVSTLTPPQDSDPDVS