Gene Details:
- Gene ID: EcC007297.50
- Gene Family: NZZ/SPL Family
- Description: NZZ/SPL Family protein
- Species: Eucalyptus camaldulensis
- Source: NZZ-SPL family gene from PlantTFDB
Protein Features:
Annotation Proteins:
- Refseq: XP_018722516.1 — PREDICTED: uncharacterized protein LOC108956893 isoform X1
- Refseq: XP_018722517.1 — PREDICTED: uncharacterized protein LOC108956893 isoform X1
- Refseq: XP_018722518.1 — PREDICTED: uncharacterized protein LOC108956893 isoform X2
- TrEMBL: A0A164ZSM3 — A0A164ZSM3_DAUCS; Uncharacterized protein
Gene Ontology:
- GO:0007264 — Biological Process — small GTPase mediated signal transduction
- GO:0015031 — Biological Process — protein transport
- GO:0016020 — Cellular Component — membrane
- GO:0003676 — Molecular Function — nucleic acid binding
- GO:0005509 — Molecular Function — calcium ion binding
- GO:0005515 — Molecular Function — protein binding
- GO:0005525 — Molecular Function — GTP binding
Family Introduction:
- The ‘floral organ-building’ gene SPOROCYTELESS/NOZZLE (SPL/NZZ) plays a central role in regulating anther cell differentiation. However, much less is known about how ‘floral organ identity’ and floral organ-building genes interact to control floral organ development. In this study, we report that ectopic expression of SPL/NZZ not only affects flower development in the wild-type background but also leads to the transformation of petal-like organs into stamen-like organs in flowers of ap2-1, a weak ap2 mutant allele. Moreover, our loss-of-function analysis indicates that the spl/nzz mutant enhances the phenotype of the ag weak allele ag-4. Furthermore, ectopic expression and overexpression of SPL/NZZ altered expression of AG, SEP3, and AP2 in rosette leaves and flowers, while ectopic expression of SPL/NZZ resulted in ectopic expression of AG and SEP3 in the outer whorls of flowers. Our results indicate that the SPL/NZZ gene is engaged in controlling stamen identity via interacting with genes required for stamen identity in Arabidopsis.
Literature:
- The SPOROCYTELESS/NOZZLE gene is involved in controlling stamen identity in Arabidopsis. DOI: 10.1104/pp.109.145896 ; PMID: 19726570
Sequences:
CDS Sequence:
- >EcC007297.50|Eucalyptus_camaldulensis|NZZ/SPL|EcC007297.50
ATGGGACAAGAAGAGAAAAATCCAAAGCGTAGCATCAGTAGTTATGGTGGCGTCAGAACAAGATCTTCCAAAAAGCAGAAGCAAAAGAAAGTGCCACAGCGAGGACTTGGAGTGGCACGGTTGGAGAAGATCAGGATTGAAGAACAACAGAAGAGCCATGCAACTGTTGCTGCAGTTTCAACTTTAACACCTCCACAAGATTCAGATCCTGATGTGTCA
Protein Sequence:
- >EcC007297.50|Eucalyptus_camaldulensis|NZZ/SPL|EcC007297.50
MGQEEKNPKRSISSYGGVRTRSSKKQKQKKVPQRGLGVARLEKIRIEEQQKSHATVAAVSTLTPPQDSDPDVS