Gene Details:
- Gene ID: Pta009797
- Gene Family: NF-YC Family
- Description: NF-YC Family protein
- Species: Pinus taeda
- Source: NF-YC family gene from PlantTFDB
Protein Features:
- Pfam: PF00808
- SuperFamily: SSF47113
- Gene3D: G3DSA:1.10.20.10
- InterPro: IPR003958 IPR009072
Annotation Proteins:
- Refseq: XP_008356118.2 — nuclear transcription factor Y subunit C-2-like
- Swissprot: Q9FMV5 — NFYC4_ARATH; Nuclear transcription factor Y subunit C-4
- TrEMBL: A9NTJ8 — A9NTJ8_PICSI; Uncharacterized protein
- STRING: XP_008346078.1 — (Malus domestica)
- STRING: XP_008356118.1 — (Malus domestica)
- STRING: XP_008372003.1 — (Malus domestica)
Gene Ontology:
- GO:0046982 — Molecular Function — protein heterodimerization activity
Family Introduction:
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- As with NF-YA, NF-YB and NF-YC families have well-described subunit interaction and DNA-binding domains ( Kim et al., 1996; Sinha et al., 1996; McNabb et al., 1997; Romier et al., 2003). The conserved regions of NF-YB and NF-YC have structural and amino acid homology to histone fold motifs. Specifically, NF-YB is related to the histone fold motifs of H2B histones, while NF-YC subunits are related to H2A histones (Mantovani, 1999).
Literature:
- Tissue-specific expression patterns of Arabidopsis NF-Y transcription factors suggest potential for extensive combinatorial complexity. DOI: 10.1104/pp.108.130591 ; PMID: 19019982
Sequences:
CDS Sequence:
- >Pta009797|Pinus_taeda|NF-YC|gnl|UG|Pta#S25797927
ATGCCGATTCGGTACGATGTAACGCCTTATCAGGCTGCGCAGAATCTGGCCCCTGTTGCTCGTGGAACGTTTCCACAGCACCAGACTTCTTCATATGTTCAAGCAGCTCACGCTTTCCCTCAGTCTGCCCATCATAATCAGTTGGCCTACCAGCACCAACTTCACCAACACCAACAGCAGCAACTCCACCACCACCAGAAGCAGCAGGTTGATTTTTTCTGGGGCAACCAGATGCAGGGAATCGAGCAATCTGTGGATTTCAGAAATCACAGCCTCCCTCTGGCGAGAATCAAGAAGATAATGAAGTCAGATGAGGATGTCAGGATGATATCTGCAGAAGCTCCGGTGGTTTTTGCCAAAGCCTGCGAGATGTTCATCAATGAACTTACTCTCAGGGCCTGGTTTCACACTGAAGAAAACAAGAGACGGACCCTGCAGAAGAACGATATAGCTGCGGCCATAGCTAGGACTGATATTTTCGATTTTCTGGTCGATATTGTGCCGAGGGATGAGTTGAAGGAGGATCAGGTTATCAATCTTGGAACCCCTACAGCTTCTCTCTCAGTTGGAAGCAGCAGTTCTAACGCTGGTGGTGCTAATTCTTTCCCTTTTTATTATCTACCCAACCAGCATTCTGCGCCACGTGGAGTCGTTGTTGGGAAACCTATGGATCCCGCTATTTATATGCAACAGCCACGGTCTCCTGTGGCCTATATGCACAATATGTTGCAGCGGGGATACATGCACACAGACGAATNN
Protein Sequence:
- >Pta009797|Pinus_taeda|NF-YC|gnl|UG|Pta#S25797927
MPIRYDVTPYQAAQNLAPVARGTFPQHQTSSYVQAAHAFPQSAHHNQLAYQHQLHQHQQQQLHHHQKQQVDFFWGNQMQGIEQSVDFRNHSLPLARIKKIMKSDEDVRMISAEAPVVFAKACEMFINELTLRAWFHTEENKRRTLQKNDIAAAIARTDIFDFLVDIVPRDELKEDQVINLGTPTASLSVGSSSSNAGGANSFPFYYLPNQHSAPRGVVVGKPMDPAIYMQQPRSPVAYMHNMLQRGYMHTDEX