Gene Details:

  • Gene ID: orange1.1g028837m
  • Gene Name: CISIN_1g028727mg
  • Gene Family: NF-YC Family
  • Description: NF-YC Family protein
  • Species: Citrus sinensis
  • Source: NF-YC family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_006488122.1  — uncharacterized protein LOC102609428 isoform X2
  • TrEMBL:  A0A067GCM3  — A0A067GCM3_CITSI; Uncharacterized protein
  • STRING:  XP_006488121.1  — (Citrus sinensis)

Gene Ontology:

  • GO:0005634  — Cellular Component — nucleus
  • GO:0046982  — Molecular Function — protein heterodimerization activity

Family Introduction:

  • NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
  • As with NF-YA, NF-YB and NF-YC families have well-described subunit interaction and DNA-binding domains ( Kim et al., 1996; Sinha et al., 1996; McNabb et al., 1997; Romier et al., 2003). The conserved regions of NF-YB and NF-YC have structural and amino acid homology to histone fold motifs. Specifically, NF-YB is related to the histone fold motifs of H2B histones, while NF-YC subunits are related to H2A histones (Mantovani, 1999).

Literature:

Sequences:

CDS Sequence:
  • >orange1.1g028837m|Citrus_sinensis|NF-YC|orange1.1g028837m
    ATGGCTTCTTCGAAGAAAAGGAAAGAAGAAAAAGCCAAACTCAAAAACGCAGAAACGAGGAAGAAGGCAAAACCAAGTCCAAAGAAACCAAAGCAGAGCAACAAGAAGACGGCGATTCAAAACGGCACCGTTAGCGAGTCCAAGGACGAGGTTGTAGTAACACCAGCTTCGTCAAGCATTAATGATTCACAGCAAGACTCGGAAACCGAACAAGAAGGCAGAAGCCAAGAACAAGAAGCGACGAATGAAAAGAAGAAGAAACCCAATAAAAATGGAAAGAAAATAGAGCGCGATGATGATGATGAGGTTTCCAAAGTATGTAATTTTCCCATGGGTAGGATTAAAAGAATTTTCAAGACTCAAAGTTCTGATATTGGTATTACTGGGGAGGCTGTTTTTCTTGTTAACAAAGCCACGGATAAGTTTCTTGAACAATTTTGTGAAGATGCATATGAATGTTGTGCTAAGGATCGTAAGAAATCGCTTGCTTACAAGCATTTAGTTGTTTCTGAACAGAGCAAATATGACTTTCTTTCAGATTATGTTCCTGAGAAAATAAAAGCTGAGGATGCATTGGCCCAGAGAGAATTAGCTGAGGGAGGGGAAGGATAG
Protein Sequence:
  • >orange1.1g028837m|Citrus_sinensis|NF-YC|orange1.1g028837m
    MASSKKRKEEKAKLKNAETRKKAKPSPKKPKQSNKKTAIQNGTVSESKDEVVVTPASSSINDSQQDSETEQEGRSQEQEATNEKKKKPNKNGKKIERDDDDEVSKVCNFPMGRIKRIFKTQSSDIGITGEAVFLVNKATDKFLEQFCEDAYECCAKDRKKSLAYKHLVVSEQSKYDFLSDYVPEKIKAEDALAQRELAEGGEG*