Information report for mrna06313.1-v1.0-hybrid
Gene Details
|
|
Functional Annotation
- Refseq: XP_011463262.1 — PREDICTED: nuclear transcription factor Y subunit C-1
- Swissprot: Q9FMV5 — NFYC4_ARATH; Nuclear transcription factor Y subunit C-4
- TrEMBL: A0A2P6P4X8 — A0A2P6P4X8_ROSCH; Putative transcription factor Hap3/NF-YB family
- STRING: XP_004297579.1 — (Fragaria vesca)
- GO:0006605 — Biological Process — protein targeting
- GO:0009738 — Biological Process — abscisic acid-activated signaling pathway
- GO:0010468 — Biological Process — regulation of gene expression
- GO:0048586 — Biological Process — regulation of long-day photoperiodism, flowering
- GO:0051247 — Biological Process — positive regulation of protein metabolic process
- GO:2000905 — Biological Process — negative regulation of starch metabolic process
- GO:0005634 — Cellular Component — nucleus
- GO:0005829 — Cellular Component — cytosol
- GO:0016020 — Cellular Component — membrane
- GO:0015450 — Molecular Function — P-P-bond-hydrolysis-driven protein transmembrane transporter activity
- GO:0046982 — Molecular Function — protein heterodimerization activity
Family Introduction
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- As with NF-YA, NF-YB and NF-YC families have well-described subunit interaction and DNA-binding domains ( Kim et al., 1996; Sinha et al., 1996; McNabb et al., 1997; Romier et al., 2003). The conserved regions of NF-YB and NF-YC have structural and amino acid homology to histone fold motifs. Specifically, NF-YB is related to the histone fold motifs of H2B histones, while NF-YC subunits are related to H2A histones (Mantovani, 1999).
Literature and News
Gene Resources
- Pfam: PF00808
- SuperFamily: SSF47113
- Gene3D: G3DSA:1.10.20.10
- InterPro: IPR003958 IPR009072
Homologs
- Citrullus lanatus: Cla019279
- Cucumis melo: MELO3C026204P1
- Cucumis sativus: Cucsa.157300.1
- Malus domestica: MDP0000246902
- Nicotiana tabacum: XP_016475903.1
- Prunus mume: XP_008239483.1, XP_008239482.1
- Prunus persica: Prupe.5G150400.1.p
- Pyrus bretschneideri: Pbr010560.1, Pbr017722.1
- Ziziphus jujuba: XP_015882147.1
Sequences
CDS Sequence:
- >mrna06313.1-v1.0-hybrid|Fragaria_vesca|NF-YC|mrna06313.1-v1.0-hybrid
ATGGAAAACAACAACTCCAACTCCAACCCCGTCGCCGCCACCACCGTCCCAGCCGCCACCTACCCTCCCACCCAGCCCCCTCCGCCGCCGTCCTCCGTCGCGGCGCCGCCCTTCCACCACCTCCTCCAGGCGCAGCAGCAGCAGCTCCAGATGTTCTGGAACTACCAGCGCCACGAGATCGAGCAGGTCAACGACTTCAAGAACCACCAGCTCCCCCTGGCGCGCATCAAGAAGATCATGAAGGCCGACGAGGACGTCAGGATGATCTCAGCCGAGGCGCCCGTCCTGTTCGCCAAGGCATGCGAGCTCTTCATCCTCGAGCTAACCATCAGGTCATGGCTCCACGCCGAGGAGAACAAGCGCCGCACGCTCCAGAAAAACGACATTGCCGCCGCCATCACCCGCACTGATATTTTCGACTTCCTCGTCGATATTGTCCCCAGGGATGAGATCAAGGACGAGGCCGGCCTCGGCGGCGTCGCCATGGTGGGGGCCACCGCCAGCGGGGTCCCTTACTACTACCCGCCCATTGGCCAGCCGGCGGGGGCGCCGGGAGGGATGATGATCGGGAGGCCGGCCATGGATCCTACCGGAGTTTATGCGCAGCCGCCGTCGCAGGCGTGGCAGTCGGTGTGGCAGACGGCGGCGGATGATGTGTCGTATGGGAGTGGAGGGAGCAGTGGCCAGGGCAATCTTGATGGCCAGAGACAACCTCCAGTGTGCAAACTCGACACACGTTCTGGTGACATCACCGGCCAACGTCCGGCAAGTGTGAGAGAAAAGAGAAAAATGGACGCCATTGACTCAGTTGTGGATCCTCTGAGAGAGTTCGCTAAGGACAGCGCTCGCCTCGTCAAGAGGTGCCACAAGCCCGATCGCAAAGAATTCTCGAAGGTTGCGTTGCGTACAGCCATTGGGTTTGTTGTGATGGGATTTGTTGGGTTTTTCGTGAAGCTCATCTTCATTCCCATCAACAACATCATCGTCGGATCTGTTTAG
Protein Sequence:
- >mrna06313.1-v1.0-hybrid|Fragaria_vesca|NF-YC|mrna06313.1-v1.0-hybrid
MENNNSNSNPVAATTVPAATYPPTQPPPPPSSVAAPPFHHLLQAQQQQLQMFWNYQRHEIEQVNDFKNHQLPLARIKKIMKADEDVRMISAEAPVLFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRTDIFDFLVDIVPRDEIKDEAGLGGVAMVGATASGVPYYYPPIGQPAGAPGGMMIGRPAMDPTGVYAQPPSQAWQSVWQTAADDVSYGSGGSSGQGNLDGQRQPPVCKLDTRSGDITGQRPASVREKRKMDAIDSVVDPLREFAKDSARLVKRCHKPDRKEFSKVALRTAIGFVVMGFVGFFVKLIFIPINNIIVGSV*