Information report for MELO3C018689P1
Gene Details
|
|
Functional Annotation
- Refseq: XP_004136852.1 — PREDICTED: nuclear transcription factor Y subunit C-2
- Refseq: XP_008455266.1 — PREDICTED: nuclear transcription factor Y subunit C-2
- Refseq: XP_008455267.1 — PREDICTED: nuclear transcription factor Y subunit C-2
- Refseq: XP_011658757.1 — PREDICTED: nuclear transcription factor Y subunit C-2
- Refseq: XP_016901763.1 — PREDICTED: nuclear transcription factor Y subunit C-2
- Swissprot: Q655V5 — NFYC4_ORYSJ; Nuclear transcription factor Y subunit C-4
- TrEMBL: A0A0A0K5U1 — A0A0A0K5U1_CUCSA; Uncharacterized protein
- TrEMBL: A0A1S3C190 — A0A1S3C190_CUCME; nuclear transcription factor Y subunit C-2
- STRING: XP_008455266.1 — (Cucumis melo)
- STRING: XP_004136852.1 — (Cucumis sativus)
- GO:0045893 — Biological Process — positive regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0005737 — Cellular Component — cytoplasm
- GO:0046982 — Molecular Function — protein heterodimerization activity
Family Introduction
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- As with NF-YA, NF-YB and NF-YC families have well-described subunit interaction and DNA-binding domains ( Kim et al., 1996; Sinha et al., 1996; McNabb et al., 1997; Romier et al., 2003). The conserved regions of NF-YB and NF-YC have structural and amino acid homology to histone fold motifs. Specifically, NF-YB is related to the histone fold motifs of H2B histones, while NF-YC subunits are related to H2A histones (Mantovani, 1999).
Literature and News
Gene Resources
- Pfam: PF00808
- SuperFamily: SSF47113
- Gene3D: G3DSA:1.10.20.10
- InterPro: IPR003958 IPR009072
Homologs
- Citrullus lanatus: Cla004399
- Citrus sinensis: orange1.1g024265m, orange1.1g024238m
- Cucumis sativus: Cucsa.345940.4, Cucsa.345940.3, Cucsa.345940.2, Cucsa.345940.1
- Fragaria vesca: mrna18500.1-v1.0-hybrid
- Juglans regia: Jr02_08530, WALNUT_00015098-RA
- Prunus mume: XP_008226142.1
- Prunus persica: Prupe.4G132200.1.p
- Ricinus communis: 30169.m006305
- Ziziphus jujuba: XP_015882054.1, XP_015882053.1, XP_015882052.1, XP_015882051.1, XP_015882050.1, XP_015882049.1
Sequences
CDS Sequence:
- >MELO3C018689P1|Cucumis_melo|NF-YC|MELO3C018689P1
ATGGATCAATCGGAGCGTTCTCAGCATCAGCAACAATCACAGCAACCTGCAGGTGGTGTGGGTGCAGGCCAATTACAATATTCTAATCCTTACCAAACAGCTCCGATGGTGGCTTCCGGAACTCCTGCTATTACAATTCCCCCAACTCAGCCACCATCCAGTTTCTCCAATTCTCCACACCAGCTTGCCTACCAGCAGGCTCAACACTTCCACCACCAGCAGCAGCAGCAGCAACAACAACAGCTCCAAATGTTTTGGGCAAACCAAATGCAAGAGATTGAACAAACAACTGACTTTAAGAACCATAGTCTCCCTCTTGCTCGAATCAAGAAAATAATGAAAGCAGATGAAGACGTCCGAATGATTTCCGCTGAAGCACCGGTTATATTTGCAAAAGCATGTGAAATGTTCATCTTGGAGTTGACTCTGCGATCATGGATTCACACAGAAGAGAACAAAAGGAGAACTTTACAGAAGAACGATATTGCAGCTGCAATTTCAAGGACAGATGTCTTTGATTTCTTGGTTGATATTATTCCAAGAGATGAACTGAAAGAGGAAGGTCTTGGAATCACAAAAGCCTCCCTTCCCGTAGTTGGTTCCCCAGCTGATCTTCCTTATTACTATGTTCCATCCCAGCATCCGGTGGGTGCTACAGGAATGATAATGGGGAAGCAATTAGATCAAGCGAACATGTATGGTGCCACTGCACAACAGCCCCGACCATCGATGCCTTTCATGCCATGGCCGCATACCCAACCACAGCAGCAACAACAAACTCAGCAGCAAAGTGATGGATAG
Protein Sequence:
- >MELO3C018689P1|Cucumis_melo|NF-YC|MELO3C018689P1
MDQSERSQHQQQSQQPAGGVGAGQLQYSNPYQTAPMVASGTPAITIPPTQPPSSFSNSPHQLAYQQAQHFHHQQQQQQQQQLQMFWANQMQEIEQTTDFKNHSLPLARIKKIMKADEDVRMISAEAPVIFAKACEMFILELTLRSWIHTEENKRRTLQKNDIAAAISRTDVFDFLVDIIPRDELKEEGLGITKASLPVVGSPADLPYYYVPSQHPVGATGMIMGKQLDQANMYGATAQQPRPSMPFMPWPHTQPQQQQQTQQQSDG*