Information report for Gh_Sca145821G01
Gene Details
|
|
Functional Annotation
- Refseq: XP_002284041.1 — PREDICTED: nuclear transcription factor Y subunit C-1 isoform X1
- Refseq: XP_003602805.1 — nuclear transcription factor Y subunit C-1 isoform X2
- Refseq: XP_004138046.1 — PREDICTED: nuclear transcription factor Y subunit C-1-like
- Refseq: XP_008464428.1 — PREDICTED: nuclear transcription factor Y subunit C-1
- Refseq: XP_009149806.1 — PREDICTED: nuclear transcription factor Y subunit C-1
- Refseq: XP_010026475.1 — PREDICTED: nuclear transcription factor Y subunit C-1
- Refseq: XP_010250693.1 — PREDICTED: nuclear transcription factor Y subunit C-1-like isoform X2
- Refseq: XP_010663766.1 — PREDICTED: nuclear transcription factor Y subunit C-1 isoform X2
- Refseq: XP_013461673.1 — nuclear transcription factor Y subunit C-1 isoform X1
- Refseq: XP_013727066.1 — nuclear transcription factor Y subunit C-1
- Refseq: XP_016169923.2 — LOW QUALITY PROTEIN: nuclear transcription factor Y subunit C-1
- Refseq: XP_022039073.1 — nuclear transcription factor Y subunit C-1-like isoform X1
- Refseq: XP_022039075.1 — nuclear transcription factor Y subunit C-1-like isoform X2
- Refseq: XP_022134838.1 — nuclear transcription factor Y subunit C-1-like
- Refseq: XP_022885495.1 — nuclear transcription factor Y subunit C-1
- Refseq: XP_022921750.1 — nuclear transcription factor Y subunit C-1-like
- Refseq: XP_022987443.1 — nuclear transcription factor Y subunit C-1
- Refseq: XP_023516854.1 — nuclear transcription factor Y subunit C-1
- Refseq: XP_028765104.1 — nuclear transcription factor Y subunit C-1-like isoform X2
- Refseq: XP_028766187.1 — nuclear transcription factor Y subunit C-1-like
- Swissprot: Q9FMV5 — NFYC4_ARATH; Nuclear transcription factor Y subunit C-4
- Swissprot: Q9SMP0 — NFYC1_ARATH; Nuclear transcription factor Y subunit C-1
- TrEMBL: A0A1U7ZPU6 — A0A1U7ZPU6_NELNU; nuclear transcription factor Y subunit C-1-like isoform X2
- TrEMBL: A0A251US04 — A0A251US04_HELAN; Putative histone-fold protein
- TrEMBL: A0A2U1M706 — A0A2U1M706_ARTAN; Nuclear transcription factor Y subunit C-1
- TrEMBL: A0A438EY75 — A0A438EY75_VITVI; Nuclear transcription factor Y subunit C-1
- TrEMBL: A0A4D9AFA2 — A0A4D9AFA2_SALSN; Uncharacterized protein
- STRING: XP_006493208.1 — (Citrus sinensis)
- STRING: evm.model.supercontig_13.107 — (Carica papaya)
- STRING: XP_008464428.1 — (Cucumis melo)
- STRING: XP_004138046.1 — (Cucumis sativus)
- STRING: Bra018046.1-P — (Brassica rapa)
- STRING: GLYMA06G17780.1 — (Glycine max)
- STRING: AES73056 — (Medicago truncatula)
- STRING: XP_007137908.1 — (Phaseolus vulgaris)
- STRING: cassava4.1_015422m — (Manihot esculenta)
- STRING: cassava4.1_034343m — (Manihot esculenta)
- STRING: Solyc03g110860.2.1 — (Solanum lycopersicum)
- STRING: XP_009779358.1 — (Nicotiana sylvestris)
- STRING: XP_009618952.1 — (Nicotiana tomentosiformis)
- STRING: XP_009619035.1 — (Nicotiana tomentosiformis)
- STRING: PGSC0003DMT400039470 — (Solanum tuberosum)
- STRING: Migut.I00537.1.p — (Erythranthe guttata)
- STRING: XP_008798937.1 — (Phoenix dactylifera)
- STRING: A0A087GWB6 — (Arabis alpina)
- STRING: XP_010026475.1 — (Eucalyptus grandis)
- STRING: XP_006436849.1 — (Citrus clementina)
- GO:0046982 — Molecular Function — protein heterodimerization activity
Family Introduction
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- As with NF-YA, NF-YB and NF-YC families have well-described subunit interaction and DNA-binding domains ( Kim et al., 1996; Sinha et al., 1996; McNabb et al., 1997; Romier et al., 2003). The conserved regions of NF-YB and NF-YC have structural and amino acid homology to histone fold motifs. Specifically, NF-YB is related to the histone fold motifs of H2B histones, while NF-YC subunits are related to H2A histones (Mantovani, 1999).
Literature and News
Gene Resources
- Pfam: PF00808
- SuperFamily: SSF47113
- Gene3D: G3DSA:1.10.20.10
- InterPro: IPR003958 IPR009072
Sequences
CDS Sequence:
- >Gh_Sca145821G01|Gossypium_hirsutum|NF-YC|Gh_Sca145821G01
ATGAAAGCCGACGAAGACGTCCGTATGATCTCCGCCGAGGCTCCCATTCTCTTCGCCAAAGCTTGTGAGCTTTTCATTTTGGAACTCACTATCCGTTCTTGGCTTCACGCCGAGGAAAACAAGCGACGGACACTTCAGAAAAACGACATCGCTGCGGCTATTACGAGGACCGACATTTTCGATTTCTTG
Protein Sequence:
- >Gh_Sca145821G01|Gossypium_hirsutum|NF-YC|Gh_Sca145821G01
MKADEDVRMISAEAPILFAKACELFILELTIRSWLHAEENKRRTLQKNDIAAAITRTDIFDFL