Information report for CA00g75200
Gene Details
|
|
Functional Annotation
- Refseq: XP_016563852.1 — PREDICTED: nuclear transcription factor Y subunit gamma-like
- Refseq: XP_016563853.1 — PREDICTED: nuclear transcription factor Y subunit gamma-like
- Refseq: XP_016563854.1 — PREDICTED: nuclear transcription factor Y subunit gamma-like
- Refseq: XP_016563855.1 — PREDICTED: nuclear transcription factor Y subunit gamma-like
- Refseq: XP_016563856.1 — PREDICTED: nuclear transcription factor Y subunit gamma-like
- Refseq: XP_016563857.1 — PREDICTED: nuclear transcription factor Y subunit gamma-like
- Refseq: XP_016563858.1 — PREDICTED: nuclear transcription factor Y subunit gamma-like
- Refseq: XP_016563859.1 — PREDICTED: nuclear transcription factor Y subunit gamma-like
- Refseq: XP_016563860.1 — PREDICTED: nuclear transcription factor Y subunit gamma-like
- Swissprot: Q9SMP0 — NFYC1_ARATH; Nuclear transcription factor Y subunit C-1
- TrEMBL: A0A1U8G566 — A0A1U8G566_CAPAN; nuclear transcription factor Y subunit gamma-like
- GO:0046982 — Molecular Function — protein heterodimerization activity
Family Introduction
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- As with NF-YA, NF-YB and NF-YC families have well-described subunit interaction and DNA-binding domains ( Kim et al., 1996; Sinha et al., 1996; McNabb et al., 1997; Romier et al., 2003). The conserved regions of NF-YB and NF-YC have structural and amino acid homology to histone fold motifs. Specifically, NF-YB is related to the histone fold motifs of H2B histones, while NF-YC subunits are related to H2A histones (Mantovani, 1999).
Literature and News
Gene Resources
- Pfam: PF00808
- SuperFamily: SSF47113
- Gene3D: G3DSA:1.10.20.10
- InterPro: IPR003958 IPR009072
Homologs
- Citrus sinensis: orange1.1g026901m
- Nicotiana attenuata: A4A49_35481
- Nicotiana benthamiana: Niben101Scf02155g02006.1, Niben101Scf21557g01020.1
- Nicotiana tabacum: XP_016511061.1, XP_016439532.1, XP_016475903.1
- Pyrus bretschneideri: Pbr010560.1
- Solanum lycopersicum: Solyc06g072040.1.1, Solyc03g110860.2.1
- Solanum tuberosum: PGSC0003DMP400026764
- Vitis vinifera: VIT_17s0000g01130
Sequences
CDS Sequence:
- >CA00g75200|Capsicum_annuum|NF-YC|CA00g75200
ATGAATGCAGCGGCGGTGGCGGCTGCGGCAGTTGGTGGGTACCCATACAATCATCAACTGGCTCAGAAACAGCAGCTAGAAATGTTTTGGCACTTCAAGCGCCACGAGATTGAGCATTCTACTAATCTGAGGAACCACCAACTTCCGCTTGCCCGAATTAGGAAAATTGCCAAAGATACCCCGAATGTCAAGAAGATTTCAGCGGAAGTGCCCATTTTGTTCTCAAAAGCGTGTGAACTGTTTATTCAGGAATTCACCCTGCGTTCATGGTTTCACGCAGATGAGAACAATCGCTACAGTATACAAGGAAATGACGTTGCTGCTGCCATTAGGCGGACTGATCATTTTGATTTCCTTGCTCATGTTCCTACGGATGAGATCATGGGAGAAGCTACTGCTGCTGCTACTGTTACTGGCGTTGTGGGCTCCACATCAAGCGGTGTTCCGGACTATAATCCACCAATGGGCCAGCCTGGTCCATCTGAAGTGACAATGGGAAGGGCTTCTGTGCCTTTGGTTCATCCGTCTGCTTATTTTCAGCCTCAGTCATGGCAGCCTACGCCATCACTGCCGCAGGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNGGAGGGGCAGCCTCAGCCGCCACCATCCCAAGAGTGCCAGTGGGTTTGGCAGCCTGTTGAGGATAATCCTGATAATCCCTCTGGTGATGGAGGTAACCCTGATGGCCACAGGTAACTTTGTCATTTCGTTAAGCTGGGGTTAG
Protein Sequence:
- >CA00g75200|Capsicum_annuum|NF-YC|CA00g75200
MNAAAVAAAAVGGYPYNHQLAQKQQLEMFWHFKRHEIEHSTNLRNHQLPLARIRKIAKDTPNVKKISAEVPILFSKACELFIQEFTLRSWFHADENNRYSIQGNDVAAAIRRTDHFDFLAHVPTDEIMGEATAAATVTGVVGSTSSGVPDYNPPMGQPGPSEVTMGRASVPLVHPSAYFQPQSWQPTPSLPQXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXRGSLSRHHPKSASGFGSLLRIILIIPLVMEVTLMATGNFVISLSWG*