Gene Details:
- Gene ID: SapurV1A.0934s0060.2.p
- Gene Family: NF-YB Family
- Description: NF-YB Family protein
- Species: Salix purpurea
- Source: NF-YB family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:1.10.20.10
- SuperFamily: SSF47113
- Pfam: PF00808
- PRINTS: PR00615
- PROSITE pattern: PS00685
- InterPro: IPR009072 IPR003958 IPR003956
Annotation Proteins:
- Refseq: XP_006374347.1 — protein Dr1 homolog
- Swissprot: P49592 — NC2B_ARATH; Protein Dr1 homolog
- TrEMBL: A0A1L6K5H4 — A0A1L6K5H4_POPTO; Repressor family protein
- TrEMBL: B9N099 — B9N099_POPTR; Uncharacterized protein
- STRING: POPTR_0015s06290.1 — (Populus trichocarpa)
Gene Ontology:
- GO:0046982 — Molecular Function — protein heterodimerization activity
Family Introduction:
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- As with NF-YA, NF-YB and NF-YC families have well-described subunit interaction and DNA-binding domains ( Kim et al., 1996; Sinha et al., 1996; McNabb et al., 1997; Romier et al., 2003). The conserved regions of NF-YB and NF-YC have structural and amino acid homology to histone fold motifs. Specifically, NF-YB is related to the histone fold motifs of H2B histones, while NF-YC subunits are related to H2A histones (Mantovani, 1999).
Literature:
- Tissue-specific expression patterns of Arabidopsis NF-Y transcription factors suggest potential for extensive combinatorial complexity. DOI: 10.1104/pp.108.130591 ; PMID: 19019982
Sequences:
CDS Sequence:
- >SapurV1A.0934s0060.2.p|Salix_purpurea|NF-YB|SapurV1A.0934s0060.2.p
ATGGAACCGATGGATATAGTTGGCAAATCGAAAGAGGATGCTTCGCTTCCTAAAGCAACTATGACCAAAATTATCAAAGAGATGTTGCCCCCAGATGTTCGTGTTGCCAGAGATGCTCAAGATCTTTTAATTGAGTGCTGTGTAGAATTTATAAATCTTGTATCGTCAGAGTCCAATGAAGTTTGTAGCAGAGAGGACAAGCGAACGATTGCTCCTGAGCATGTACTCAAGGCTTTAGAGGTTCTAGGGTTTGGAGAGTACATTGAGGAGGTTTATGCTGCATATGAGCAACACAAGCTAGAGACTATGCATGACTCTTTAAAAGGTGGTAAATGGAGCAATGGAGCGGCAATGACCGAGGAAGAGGCAGCCGCTGCGCAGCAAAGGATGTTTGATGAGGCGCGTGCTAGAATGAATGGTGGGGTCACTGCCCCAAAGCAACCAGAGACTAACCATAGTTTAAAGAGCTAA
Protein Sequence:
- >SapurV1A.0934s0060.2.p|Salix_purpurea|NF-YB|SapurV1A.0934s0060.2.p
MEPMDIVGKSKEDASLPKATMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLVSSESNEVCSREDKRTIAPEHVLKALEVLGFGEYIEEVYAAYEQHKLETMHDSLKGGKWSNGAAMTEEEAAAAQQRMFDEARARMNGGVTAPKQPETNHSLKS*