Gene Details:

  • Gene ID: PGSC0003DMP400042874
  • Gene Name: LOC102604033
  • Gene Family: NF-YB Family
  • Description: NF-YB Family protein
  • Species: Solanum tuberosum
  • Source: NF-YB family gene from PlantTFDB

Protein Features:

Annotation Proteins:

  • Refseq:  XP_006344838.1  — PREDICTED: nuclear transcription factor Y subunit B-5-like
  • Swissprot:  O82248  — NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
  • TrEMBL:  M1CB00  — M1CB00_SOLTU; Uncharacterized protein
  • STRING:  PGSC0003DMT400063671  — (Solanum tuberosum)

Gene Ontology:

  • GO:0006355  — Biological Process — regulation of transcription, DNA-templated
  • GO:0005634  — Cellular Component — nucleus
  • GO:0043565  — Molecular Function — sequence-specific DNA binding
  • GO:0046982  — Molecular Function — protein heterodimerization activity

Family Introduction:

  • NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
  • As with NF-YA, NF-YB and NF-YC families have well-described subunit interaction and DNA-binding domains ( Kim et al., 1996; Sinha et al., 1996; McNabb et al., 1997; Romier et al., 2003). The conserved regions of NF-YB and NF-YC have structural and amino acid homology to histone fold motifs. Specifically, NF-YB is related to the histone fold motifs of H2B histones, while NF-YC subunits are related to H2A histones (Mantovani, 1999).

Literature:

Sequences:

CDS Sequence:
  • >PGSC0003DMP400042874|Solanum_tuberosum|NF-YB|PGSC0003DMP400042874
    ATGGTGGATGAACAAGTGAAATTGGTACCAATAGCCAATGTAGGAAGGATTATGAAACAAATCTTGCCACCAACAGCCAAAATATCCAAAGAAGCAAAAGAGACAATGCAAGAATGTGCATCAGAATTTATAAGTTTTGTAACAGGTGAAGCATCTGACAAGTGTCAAAAGGAGAATCGTCGAACGGTTAATGGAGATGACATCTGTTGGGCTCTGAGTTCACTTGGTTTTGACAACTATGCAGAGGTTATGTTGAGGTACTTGTATAAGTTGAGGGACTTTGAAAGAGTCAGAGCTAATCAAAATAAATTAGGTTTAAATGAAGATGATGAAGATAATAGAGATGATGAAGAAGCTCCAAGTGCACCATTAGAGTTTAATATAATGGAAAGGGTGCAACGTAGACGCTTCAATTAA
Protein Sequence:
  • >PGSC0003DMP400042874|Solanum_tuberosum|NF-YB|PGSC0003DMP400042874
    MVDEQVKLVPIANVGRIMKQILPPTAKISKEAKETMQECASEFISFVTGEASDKCQKENRRTVNGDDICWALSSLGFDNYAEVMLRYLYKLRDFERVRANQNKLGLNEDDEDNRDDEEAPSAPLEFNIMERVQRRRFN*