Information report for Gh_D05G2854
Gene Details
|
|
Functional Annotation
- Refseq: XP_012447849.1 — PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
- Refseq: XP_012447850.1 — PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
- Refseq: XP_012447851.1 — PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
- Refseq: XP_016685850.1 — PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
- Refseq: XP_016685851.1 — PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
- Refseq: XP_016685852.1 — PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
- Refseq: XP_016685853.1 — PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
- Refseq: XP_016748326.1 — PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
- Refseq: XP_016748327.1 — PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
- Refseq: XP_016748328.1 — PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
- Refseq: XP_017607610.1 — PREDICTED: nuclear transcription factor Y subunit B-1-like isoform X1
- Swissprot: Q8VYK4 — NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
- TrEMBL: A0A0D2QRI7 — A0A0D2QRI7_GOSRA; Uncharacterized protein
- TrEMBL: A0A1U8J678 — A0A1U8J678_GOSHI; nuclear transcription factor Y subunit B-1-like isoform X1
- STRING: Gorai.009G315600.1 — (Gossypium raimondii)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0005634 — Cellular Component — nucleus
- GO:0043565 — Molecular Function — sequence-specific DNA binding
- GO:0046982 — Molecular Function — protein heterodimerization activity
Family Introduction
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- As with NF-YA, NF-YB and NF-YC families have well-described subunit interaction and DNA-binding domains ( Kim et al., 1996; Sinha et al., 1996; McNabb et al., 1997; Romier et al., 2003). The conserved regions of NF-YB and NF-YC have structural and amino acid homology to histone fold motifs. Specifically, NF-YB is related to the histone fold motifs of H2B histones, while NF-YC subunits are related to H2A histones (Mantovani, 1999).
Literature and News
Gene Resources
Homologs
- Citrus sinensis: orange1.1g030547m
- Gossypium arboreum: Cotton_A_21066_BGI-A2_v1.0
- Manihot esculenta: Manes.10G041500.1.p
- Populus trichocarpa: Potri.010G216600.3, Potri.010G216600.4, Potri.008G044800.5, Potri.008G044800.3, Potri.008G044800.2, Potri.010G216600.2
- Ricinus communis: 29923.m000817
Sequences
CDS Sequence:
- >Gh_D05G2854|Gossypium_hirsutum|NF-YB|Gh_D05G2854
ATGGCGGATGGTATGGGAGGAGGGCCAACTAGTCCGGCAGGAGGGAGCCATGAGAGCGGAGGAGAGCACAGCAGTCCTCAGTCAACTGTGAGGGAACAAGATCGTTACCTCCCAATTGCTAATATAAGTAGAATCATGAAGAAAGCCTTGCCTTCTAATGGGAAAATTGCTAAGGATGCTAAAGATACTGTTCAAGAATGTGTTTCCGAGTTCATCAGCTTCATCACTAGCGAGGCAAGTGATAAATGTCAAAAAGAGAAAAGGAAGACAATTAATGGAGATGACTTGTTGTGGGCAATGGCAACATTAGGATTCGAAGACTATATCGAGCCACTTAAAATATATCTTGCCAGATACAGGGAGTTGGAGGGTGACACCAAGGGATCAGCCCGTGGTGGTGATGGATCTTTTAAAAGAGACGCAGCTGGAGCTCTTCCTGCCCAAAATCCACAGTTTTCAATCCAGGGGTCATTGAACTATATTAATTCCCAAGCACAAGGACAGCATATGATCATTCCCTCCATGCAAGGCAATGAGTAA
Protein Sequence:
- >Gh_D05G2854|Gossypium_hirsutum|NF-YB|Gh_D05G2854
MADGMGGGPTSPAGGSHESGGEHSSPQSTVREQDRYLPIANISRIMKKALPSNGKIAKDAKDTVQECVSEFISFITSEASDKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKIYLARYRELEGDTKGSARGGDGSFKRDAAGALPAQNPQFSIQGSLNYINSQAQGQHMIIPSMQGNE