Information report for EcC054698.80
Gene Details
|
|
Functional Annotation
- Refseq: XP_010031455.1 — PREDICTED: protein Dr1 homolog isoform X1
- Refseq: XP_010031462.1 — PREDICTED: protein Dr1 homolog isoform X1
- Refseq: XP_018723264.1 — PREDICTED: protein Dr1 homolog isoform X1
- Refseq: XP_018723265.1 — PREDICTED: protein Dr1 homolog isoform X1
- Swissprot: P49592 — NC2B_ARATH; Protein Dr1 homolog
- TrEMBL: A0A059D039 — A0A059D039_EUCGR; Uncharacterized protein
- STRING: XP_010031447.1 — (Eucalyptus grandis)
- GO:0006096 — Biological Process — glycolytic process
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0006468 — Biological Process — protein phosphorylation
- GO:0007018 — Biological Process — microtubule-based movement
- GO:0009446 — Biological Process — putrescine biosynthetic process
- GO:0015914 — Biological Process — phospholipid transport
- GO:0055114 — Biological Process — oxidation-reduction process
- GO:0000015 — Cellular Component — phosphopyruvate hydratase complex
- GO:0005730 — Cellular Component — nucleolus
- GO:0016021 — Cellular Component — integral component of membrane
- GO:0000287 — Molecular Function — magnesium ion binding
- GO:0003697 — Molecular Function — single-stranded DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0003723 — Molecular Function — RNA binding
- GO:0003777 — Molecular Function — microtubule motor activity
- GO:0004012 — Molecular Function — phospholipid-translocating ATPase activity
- GO:0004634 — Molecular Function — phosphopyruvate hydratase activity
- GO:0004668 — Molecular Function — protein-arginine deiminase activity
- GO:0004672 — Molecular Function — protein kinase activity
- GO:0005509 — Molecular Function — calcium ion binding
- GO:0005524 — Molecular Function — ATP binding
- GO:0008017 — Molecular Function — microtubule binding
- GO:0016702 — Molecular Function — oxidoreductase activity, acting on single donors with incorporation of molecular oxygen, incorporation of two atoms of oxygen
- GO:0016844 — Molecular Function — strictosidine synthase activity
- GO:0046982 — Molecular Function — protein heterodimerization activity
- GO:0047632 — Molecular Function — agmatine deiminase activity
Family Introduction
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- As with NF-YA, NF-YB and NF-YC families have well-described subunit interaction and DNA-binding domains ( Kim et al., 1996; Sinha et al., 1996; McNabb et al., 1997; Romier et al., 2003). The conserved regions of NF-YB and NF-YC have structural and amino acid homology to histone fold motifs. Specifically, NF-YB is related to the histone fold motifs of H2B histones, while NF-YC subunits are related to H2A histones (Mantovani, 1999).
Literature and News
Gene Resources
Sequences
CDS Sequence:
- >EcC054698.80|Eucalyptus_camaldulensis|NF-YB|EcC054698.80
ATGGACCCGATGGATATAGTGGGGAAATCGAAGGAGGATGCGTCNNNNNNNNNNNCAACTATGACAAAAATTATAAAGGAAATGCTACCGCCCGATGTTCGTGTTGCACGAGATGCTCAGGATCTATTAATTGAGTGTTGTGTAGAGTTCATAAACCTGGTGTCATCTGAATCGAATGATGTTTGTAATCGGGAGGAGAAAAGAACGATTGCTCCTGAGCATGTACTCAAGGCATTAGAGGTTCTTGGGTTTGGGGAGTACATTGAAGAGGTTTATGCAGCTTATGAACAACATAAGCACGAGACAATGCAGGATTCTCTTAAAGGTGGTAAATGGAGTAATGGAGCCGAGATGACTGAAGAAGCATTGCTAGCAGAACAGCAAAGGATGTTTGCCGAGGCACGTGCCAGGATGAATGGTGGGGCAGCCGTCCCCAAACAAGCAGATGTAGACTCTAATGTAGAGAGCTAA
Protein Sequence:
- >EcC054698.80|Eucalyptus_camaldulensis|NF-YB|EcC054698.80
MDPMDIVGKSKEDAXXXXXTMTKIIKEMLPPDVRVARDAQDLLIECCVEFINLVSSESNDVCNREEKRTIAPEHVLKALEVLGFGEYIEEVYAAYEQHKHETMQDSLKGGKWSNGAEMTEEALLAEQQRMFAEARARMNGGAAVPKQADVDSNVES