Gene Details:
- Gene ID: AT2G38880.7
- Gene Name: ATHAP3, ATNF-YB1, HAP3, HAP3A, NF-YB1
- Gene Family: NF-YB Family
- Description: NF-YB Family protein
- Species: Arabidopsis thaliana
- Source: NF-YB family gene from PlantTFDB
Protein Features:
- Gene3D: G3DSA:1.10.20.10
- SuperFamily: SSF47113
- Pfam: PF00808
- PRINTS: PR00615
- PROSITE pattern: PS00685
- InterPro: IPR009072 IPR003958 IPR003956
Annotation Proteins:
- Refseq: NP_001189704.1 — nuclear factor Y, subunit B1
- Swissprot: Q9SLG0 — NFYB1_ARATH; Nuclear transcription factor Y subunit B-1
- TrEMBL: F4ITZ4 — F4ITZ4_ARATH; Nuclear factor Y, subunit B1
- STRING: scaffold_402629.1 — (Arabidopsis lyrata)
- STRING: Bostr.23794s0182.1.p — (Boechera stricta)
Gene Ontology:
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0009414 — Biological Process — response to water deprivation
- GO:0005634 — Cellular Component — nucleus
- GO:0016602 — Cellular Component — CCAAT-binding factor complex
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
- GO:0005515 — Molecular Function — protein binding
- GO:0043565 — Molecular Function — sequence-specific DNA binding
- GO:0046982 — Molecular Function — protein heterodimerization activity
Family Introduction:
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- As with NF-YA, NF-YB and NF-YC families have well-described subunit interaction and DNA-binding domains ( Kim et al., 1996; Sinha et al., 1996; McNabb et al., 1997; Romier et al., 2003). The conserved regions of NF-YB and NF-YC have structural and amino acid homology to histone fold motifs. Specifically, NF-YB is related to the histone fold motifs of H2B histones, while NF-YC subunits are related to H2A histones (Mantovani, 1999).
Literature:
- Tissue-specific expression patterns of Arabidopsis NF-Y transcription factors suggest potential for extensive combinatorial complexity. DOI: 10.1104/pp.108.130591 ; PMID: 19019982
Sequences:
CDS Sequence:
- >AT2G38880.7|Arabidopsis_thaliana|NF-YB|AT2G38880.7
ATGGCGGATACGCCTTCGAGCCCAGCTGGAGATGGCGGAGAAAGCGGCGGTTCCGTTAGGGAGCAGGATCGATACCTTCCTATAGCTAATATCAGCAGGATCATGAAGAAAGCGTTGCCTCCTAATGGTAAGATTGGAAAAGATGCTAAGGATACAGTTCAGGAATGCGTCTCTGAGTTCATCAGCTTCATCACTAGCGAGGCCAGTGATAAGTGTCAAAAAGAGAAAAGGAAAACTGTGAATGGTGATGATTTGTTGTGGGCAATGGCAACATTAGGATTTGAGGATTACCTGGAACCTCTAAAGATATACCTAGCGAGGTACAGGGAGGGTGATAATAAGGGATCAGGAAAGAGTGGAGATGGATCAAATAGAGATGCTGGTGGCGGTGTTTCTGGTGAAGAAATGCCGAGCTGGTAA
Protein Sequence:
- >AT2G38880.7|Arabidopsis_thaliana|NF-YB|AT2G38880.7
MADTPSSPAGDGGESGGSVREQDRYLPIANISRIMKKALPPNGKIGKDAKDTVQECVSEFISFITSEASDKCQKEKRKTVNGDDLLWAMATLGFEDYLEPLKIYLARYREGDNKGSGKSGDGSNRDAGGGVSGEEMPSW