Information report for Lus10021259
Gene Details
|
|
Functional Annotation
- Refseq: XP_021688502.1 — nuclear transcription factor Y subunit A-10-like
- Refseq: XP_021688503.1 — nuclear transcription factor Y subunit A-10-like
- Refseq: XP_021688506.1 — nuclear transcription factor Y subunit A-10-like
- TrEMBL: A0A1Q3B7W7 — A0A1Q3B7W7_CEPFO; CBFB_NFYA domain-containing protein
- STRING: Lus10021259 — (Linum usitatissimum)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0016602 — Cellular Component — CCAAT-binding factor complex
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- NF-YA proteins are characterized by the presence of Gln(Q)- and Ser/Thr(S/T)-rich NH2 termini, a subunit interaction domain (NF-YB/NF-YC interaction), and a DNA-binding domain (Olesen and Guarente, 1990; Maity and de Crombrugghe, 1992; Xing et al., 1993, 1994). The protein interaction and DNA binding domains are well conserved between plant and other eukaryote lineages.
Literature and News
Gene Resources
Homologs
- Cicer arietinum: XP_004494259.1
- Citrus sinensis: orange1.1g021081m
- Daucus carota: DCAR_020690
- Gossypium hirsutum: Gh_A01G1710
- Juglans regia: WALNUT_00006637-RA, WALNUT_00022204-RA
- Manihot esculenta: Manes.09G044200.1.p, Manes.08G034700.1.p
- Populus trichocarpa: Potri.016G068200.2, Potri.016G068200.1, Potri.006G201900.1, Potri.006G201900.2
- Prunus mume: XP_016651667.1, XP_008241076.1
- Prunus persica: Prupe.7G093100.2.p, Prupe.7G093100.1.p
- Ricinus communis: 29333.m001059
- Vitis vinifera: GSVIVT01022601001
- Ziziphus jujuba: XP_015900396.1, XP_015900395.1
Sequences
CDS Sequence:
- >Lus10021259|Linum_usitatissimum|NF-YA|Lus10021259
ATGACTATGAAGACACTCTACTTCAAAGAACATGAAGGGATTGCTCAGAACCCTGTTGGGCAGCTATCTTCTTCTTCTTCTTCTGCGCCAACAACAGTGCCATGGTGGAATGTGATGGGATCTCAACCTGCTTACGTGGAGTCCCAATTGAAGGCTTTCTCTGTTGAGGGTGGAGACCAGGTCACTGCCACTAAGCAGACTTCCCCAACCATTGATCAAGGACAAGATGGTCTGGGGAAGGAGGCTCATACTGAGTTCAATATCTTCCCAGCCTCTTCAGGAAATAGCAAATCCATCAGTGAGGGGCAAAAGGCTGTGCCAGCCCAGTCATTTTTCCCTCTGCAAGCAACCATGGTGGCTCCGTATGACTTGGGATTTGGTCAGCAAATGATCTGTGCAAAATATCCTCCTATTGATCAATATTATGGCATTTTCTCAGCTTATGGACCTCAAATTCCGGGTAGGATCATGCTGCCAATGGACATGAGCACGGATGAGGGACCTATTTATGTGAATGCTAAGCAATATCATGGAATCCTCAGGCGTCGTAAGTCTCGTGCAAAAGCTGAAATGGAGAACAAACTAAGCAGAACTCGCAAGCAATACATGCACCATTCGCGCCATCTCCATGCAATGCGTAGACCAAGGGGAAGCGGTGGCCGTTTCTTGACCAAAATGGAGATCGACAAAATGACCAGAGAAGGACACAACTTTCACCTATCTCAGCCCACAGGCTCCCAGAGTTCTGGAGGAGGAGGCCTGCTGCAGTCTGATAGTGGAGGCTCTGCAAACTCCTCAAAGGAAGCAAATGGTTATAGGGGTGGCGGGATGAATCATCATCATCATCATAATCGTTCGGGGTCCGAAGTAACCAGCCTCTTCTCCAGAGATGAAGAAGACATGGGTGGTTGCTTCCAGATCAAGAATATGATGCCACCTTTCCATTCCTTCCCAGGCATGATGAATACTGGACATGACATTGTCATGCCCAGCAGTAAGTGGGTTGCTGCTGCAGTGGATAACTGCAGCAGCAACCTCAAAGTTTAA
Protein Sequence:
- >Lus10021259|Linum_usitatissimum|NF-YA|Lus10021259
MTMKTLYFKEHEGIAQNPVGQLSSSSSSAPTTVPWWNVMGSQPAYVESQLKAFSVEGGDQVTATKQTSPTIDQGQDGLGKEAHTEFNIFPASSGNSKSISEGQKAVPAQSFFPLQATMVAPYDLGFGQQMICAKYPPIDQYYGIFSAYGPQIPGRIMLPMDMSTDEGPIYVNAKQYHGILRRRKSRAKAEMENKLSRTRKQYMHHSRHLHAMRRPRGSGGRFLTKMEIDKMTREGHNFHLSQPTGSQSSGGGGLLQSDSGGSANSSKEANGYRGGGMNHHHHHNRSGSEVTSLFSRDEEDMGGCFQIKNMMPPFHSFPGMMNTGHDIVMPSSKWVAAAVDNCSSNLKV*