Information report for Lus10016411
Gene Details
|
|
Functional Annotation
- Refseq: XP_020532892.1 — nuclear transcription factor Y subunit A-1
- Refseq: XP_020532893.1 — nuclear transcription factor Y subunit A-1
- Refseq: XP_020532894.1 — nuclear transcription factor Y subunit A-1
- Refseq: XP_020532895.1 — nuclear transcription factor Y subunit A-1
- Refseq: XP_020532896.1 — nuclear transcription factor Y subunit A-1
- TrEMBL: A0A067LH09 — A0A067LH09_JATCU; Uncharacterized protein
- TrEMBL: A0A2I4KKY3 — A0A2I4KKY3_POPTR; NF-YA family protein
- STRING: Lus10016411 — (Linum usitatissimum)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0016602 — Cellular Component — CCAAT-binding factor complex
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- NF-YA proteins are characterized by the presence of Gln(Q)- and Ser/Thr(S/T)-rich NH2 termini, a subunit interaction domain (NF-YB/NF-YC interaction), and a DNA-binding domain (Olesen and Guarente, 1990; Maity and de Crombrugghe, 1992; Xing et al., 1993, 1994). The protein interaction and DNA binding domains are well conserved between plant and other eukaryote lineages.
Literature and News
Gene Resources
Homologs
- Juglans regia: WALNUT_00001407-RA
- Manihot esculenta: MANES_10G141400, Manes.10G141400.1.p
- Populus trichocarpa: POPTR_009G060600v3, Potri.009G060600.1, Potri.009G060600.6, Potri.009G060600.5, Potri.009G060600.4, Potri.009G060600.3, Potri.009G060600.2, POPTR_001G266000v3, Potri.001G266000.4, Potri.001G266000.3, Potri.001G266000.1, Potri.001G266000.2
- Prunus persica: Prupe.2G014500.1.p
- Ricinus communis: 29864.m001503
Sequences
CDS Sequence:
- >Lus10016411|Linum_usitatissimum|NF-YA|Lus10016411
ATGCCTGCGAAATCTGACGACAAACAACAGCATATAGATCAATCTGCTCAAACTCTACTGAATTCCACAATCTACTCCCAACCTTGGTGGAGAGGGATTGGACACAGCAATTCCACCTTTGAGGAAAGTAGGCGAAAGTCAAATTCTTCGTCGTCATCAGTGGAACACTTGAAAGTTTCTGATGCAAATGAAGCTATGCAGCGGTCGGATGGCTTAGACAATGGAGTTAGCTTCAACAAAGATATACAGACTACTGTATCATCACAACTAGCTGCGAGTGTCTTTTCTCGAACAGATGGAAGTGGTGGGACTGCGAAAGAGGTTCCACAATCGACGCAAATTAGTGCTATGGGCGGACATCCCGAGCATAATTCGCAAATGAAACTTGTCGGTCACTCTATTGTGAGCGTTCTCTCTTTCTGTGGCCTTATATGGATCCTTCACTTGGATTATGCTCTGTCATCGTATCCATTTTCTGATCCTCAATACGGTGGAATGATGGCTACGTTTGGCCCGCAAGCTATGGTACATCCTCACTTGTATGGCATGCAGCATGCTAGAATGCCTCTGCCCCTTGAAATGGAAGAGGAGCCTGTTTATGTTAATGCGAAGCAGTTTCATGGTATCTTGCGCCGTAGGCAAGCGCGTGCCAAGGCTGAACTCGAGAAGAAAGTGCAAAAACCTAGGAAGCCATATCTTCACGAGTCTCGTCACCAGCATGCCATGAAAAGGGCAAGAGGCGGCGGTGGTCGTTTCCTTAGCTCGAAGAAGCAGGACGGCCATTCCATGAATCCAGGTGCTGCTGCCAAGACTGCAAAGCAATCCGGAGGAAAGCTCTCAGCCCCCAACTGGTTCCCCACGAACCATACCGGAGATTTTCATTCATATCATCACTCGTCGTCAGCTGATGGAATCAATGGAGGAGGAGGCAGACATGGGAATGCGGTGTCGAATACCGCTTAA
Protein Sequence:
- >Lus10016411|Linum_usitatissimum|NF-YA|Lus10016411
MPAKSDDKQQHIDQSAQTLLNSTIYSQPWWRGIGHSNSTFEESRRKSNSSSSSVEHLKVSDANEAMQRSDGLDNGVSFNKDIQTTVSSQLAASVFSRTDGSGGTAKEVPQSTQISAMGGHPEHNSQMKLVGHSIVSVLSFCGLIWILHLDYALSSYPFSDPQYGGMMATFGPQAMVHPHLYGMQHARMPLPLEMEEEPVYVNAKQFHGILRRRQARAKAELEKKVQKPRKPYLHESRHQHAMKRARGGGGRFLSSKKQDGHSMNPGAAAKTAKQSGGKLSAPNWFPTNHTGDFHSYHHSSSADGINGGGGRHGNAVSNTA*