Information report for GSMUA_AchrUn_randomP15140_001
Gene Details
|
|
Functional Annotation
- Refseq: XP_009387069.1 — PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
- Refseq: XP_009387071.1 — PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
- Refseq: XP_009387074.1 — PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
- Refseq: XP_018677229.1 — PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
- Refseq: XP_018677230.1 — PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
- Refseq: XP_018677231.1 — PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
- Refseq: XP_018677232.1 — PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
- Refseq: XP_018677233.1 — PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
- Refseq: XP_018677234.1 — PREDICTED: nuclear transcription factor Y subunit A-7-like isoform X1
- Swissprot: Q93ZH2 — NFYA3_ARATH; Nuclear transcription factor Y subunit A-3
- TrEMBL: M0U9C3 — M0U9C3_MUSAM; Uncharacterized protein
- STRING: GSMUA_AchrUn_randomP15140_001 — (Musa acuminata)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0016602 — Cellular Component — CCAAT-binding factor complex
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- NF-YA proteins are characterized by the presence of Gln(Q)- and Ser/Thr(S/T)-rich NH2 termini, a subunit interaction domain (NF-YB/NF-YC interaction), and a DNA-binding domain (Olesen and Guarente, 1990; Maity and de Crombrugghe, 1992; Xing et al., 1993, 1994). The protein interaction and DNA binding domains are well conserved between plant and other eukaryote lineages.
Literature and News
Gene Resources
Homologs
- Setaria italica: Seita.9G521100.1.p, Seita.9G521100.2.p
- Setaria viridis: Sevir.9G525800.1.p, Sevir.9G525800.3.p, Sevir.9G525800.2.p, Sevir.9G525800.4.p
- Triticum aestivum: Traes_2DS_69FBC78BC.2, Traes_2BS_A95B28510.1, Traes_2AS_7C177F9DB.1
Sequences
CDS Sequence:
- >GSMUA_AchrUn_randomP15140_001|Musa_acuminata|NF-YA|GSMUA_AchrUn_randomP15140_001
ATGGGTTTCTTGGCGAAAGATGGCAACCAAGTAAAGCAATTAAGCCATCCAATATCTGACCATGATTCATCAACTCAGTCCACTGGTCAATCCTGTCAAGAAGCATCAGGAACGAGTGAAGACAATGTTCATGAGCAACATATTTCAGTAAACTCTGGTGTTGGTAATACATACAAGAATTTGGTTGATGGTCATATGAAGCCCATTTTATCTCTGGGAACTTCAGAAACTGCATTTTCATTTCCAAAACTGGATTATAGCCAGTCTTTTGCTCATGTGCCTTACCCTTGTGCTGACCCATACTTTGGTGGTATCCTTGCGTTGTGCGGACCACATGCTATGATTCATCCACAAATGGTGGGAATAGCGTCCTCTGGTAGAGTTCCACTGCCTCTTCAACCTGCAGCAGAAGAGCCACTTTATGTCAATGCGAAACAATATAATGCAATACTTCGAAGGAGGCAACTGCGAGCAAAGTTGGAGGCTCAAAATAAACTCATAAAGGCTAGAAAGCCATATCTTCATGAGTCTCGCCACCTTCATGCAATGAAGAGGGCAAGAGGATCTGGCGGACGGTTCCTCAACACAAAGCAGCTCCAGCAGCAGAAGCAGACCCAGACTTCGGCAATATCAGGTTGCCAGGATCACTCTGGCTCAAAGCTCTGCTCAGGAAGCGGCTCGATTGGTTCATCTGCCCCTTCGATCAACTCCAACATCAGAACTGCTTCTACGAACGGAAGCATGTTAACACAGCAGGATCACTTGAGCTTTCCATTTCCCGATTTCCATTCAAACGTCGGAGTGGGCACACAAGGCGGACATACCATGATGGGTGGTGTGGTTCAGAGCTTCAACTGCTCAAACAAATGCATGGATCCTACCCTCGTTGTAACTTTATGGAGTGTTGACAATTTATTGGAAATCTTGTTCTTATCTTGA
Protein Sequence:
- >GSMUA_AchrUn_randomP15140_001|Musa_acuminata|NF-YA|GSMUA_AchrUn_randomP15140_001
MGFLAKDGNQVKQLSHPISDHDSSTQSTGQSCQEASGTSEDNVHEQHISVNSGVGNTYKNLVDGHMKPILSLGTSETAFSFPKLDYSQSFAHVPYPCADPYFGGILALCGPHAMIHPQMVGIASSGRVPLPLQPAAEEPLYVNAKQYNAILRRRQLRAKLEAQNKLIKARKPYLHESRHLHAMKRARGSGGRFLNTKQLQQQKQTQTSAISGCQDHSGSKLCSGSGSIGSSAPSINSNIRTASTNGSMLTQQDHLSFPFPDFHSNVGVGTQGGHTMMGGVVQSFNCSNKCMDPTLVVTLWSVDNLLEILFLS