Information report for Gh_A07G0129
Gene Details
|
|
Functional Annotation
- Refseq: XP_016716880.1 — PREDICTED: nuclear transcription factor Y subunit A-5-like
- Refseq: XP_016716881.1 — PREDICTED: nuclear transcription factor Y subunit A-5-like
- Refseq: XP_016716883.1 — PREDICTED: nuclear transcription factor Y subunit A-5-like
- Refseq: XP_016716884.1 — PREDICTED: nuclear transcription factor Y subunit A-5-like
- Refseq: XP_016716885.1 — PREDICTED: nuclear transcription factor Y subunit A-5-like
- Refseq: XP_016716886.1 — PREDICTED: nuclear transcription factor Y subunit A-5-like
- Refseq: XP_016716887.1 — PREDICTED: nuclear transcription factor Y subunit A-5-like
- Refseq: XP_016716889.1 — PREDICTED: nuclear transcription factor Y subunit A-5-like
- TrEMBL: A0A1U8LUJ2 — A0A1U8LUJ2_GOSHI; nuclear transcription factor Y subunit A-5-like
- TrEMBL: A0A2P5WVV5 — A0A2P5WVV5_GOSBA; Uncharacterized protein
- STRING: Gorai.001G014200.1 — (Gossypium raimondii)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- NF-YA proteins are characterized by the presence of Gln(Q)- and Ser/Thr(S/T)-rich NH2 termini, a subunit interaction domain (NF-YB/NF-YC interaction), and a DNA-binding domain (Olesen and Guarente, 1990; Maity and de Crombrugghe, 1992; Xing et al., 1993, 1994). The protein interaction and DNA binding domains are well conserved between plant and other eukaryote lineages.
Literature and News
Gene Resources
Homologs
- Gossypium arboreum: Cotton_A_05707_BGI-A2_v1.0, Cotton_A_03153_BGI-A2_v1.0, Cotton_A_06685_BGI-A2_v1.0
- Manihot esculenta: Manes.16G097900.2.p, Manes.16G097900.1.p
- Populus trichocarpa: Potri.006G145100.4, Potri.006G145100.3, Potri.006G145100.2
Sequences
CDS Sequence:
- >Gh_A07G0129|Gossypium_hirsutum|NF-YA|Gh_A07G0129
ATGGCTAGTCGGGTTCGAATCTTGCCGAAGGAAAATTTACTTATTAGTTGCCCACCGTGGTGTAATTCAAACGAACAGCAATTTGTTGAGATTGTACCACAGAATGTGAGCTTGAAGAAAGCAGAAAATCGCTCTCAACTATATCATAATGCAAAGCGTTTCGATCTTCAACTACTAGACCACGAACCAACATTAGCTGAAGCAGGTGTCACGGGAGTGAACAATTCGCAATGCAATTCTTCGGAATCTGGTCAGGTTGAAAGTTGCAGGAAAGACATCGAAGGTCAAACGAAGCCGGTTTACTTGCTTAACAACCCAAACACATTGTTAAGCCCTTCTCATCCAAACTATAACCATTCAATGGCTTGTGCTCAATATCCTTACACCGATGCTTACTTTACCGGGCTATTTACTCCGAATGGGCAACAGACTATTGCCCAGATGACCGGAACTGCACCAACTCGAATTCCGCTGCCTCTTGATCTTGCAGAAGACGAGCCCATTTACGTCAATCCGAAACAATATCATGGGATTCTCAGGAGGAGGCGACATCGTGCAAAGCTCGAGACGCGAATCAAACTCGTTAAATCTCGAAAGCCATACCTTCACGAATCTCGCCATCTTCATGCAATGAATCGAATTCGGGGATCCGGCGGACGTTTTCTTAGCAAAAAGAAACCGCAATGGTCCGATCCAACCTCCAATTACATCTTGGATATCGGTTGCTTCGACCAAAAGGATAATAATGGATCGGAACTTGAGAGCCGTTGCTCACATACGGCAGAATACGGTGGTTCATGTACGAGCTGCTCCAACATTTCAAGTATCACCAACAATGGTGGCGACATATCTCGCCGTGCGGTCAGTTCGTGCAATGGAATACAAAACTGTGCTTCGCTTGTCCGGTGA
Protein Sequence:
- >Gh_A07G0129|Gossypium_hirsutum|NF-YA|Gh_A07G0129
MASRVRILPKENLLISCPPWCNSNEQQFVEIVPQNVSLKKAENRSQLYHNAKRFDLQLLDHEPTLAEAGVTGVNNSQCNSSESGQVESCRKDIEGQTKPVYLLNNPNTLLSPSHPNYNHSMACAQYPYTDAYFTGLFTPNGQQTIAQMTGTAPTRIPLPLDLAEDEPIYVNPKQYHGILRRRRHRAKLETRIKLVKSRKPYLHESRHLHAMNRIRGSGGRFLSKKKPQWSDPTSNYILDIGCFDQKDNNGSELESRCSHTAEYGGSCTSCSNISSITNNGGDISRRAVSSCNGIQNCASLVR