Information report for Gh_A05G0961
Gene Details
|
|
Functional Annotation
- Refseq: XP_016749806.1 — PREDICTED: nuclear transcription factor Y subunit A-7-like
- Refseq: XP_016749808.1 — PREDICTED: nuclear transcription factor Y subunit A-7-like
- Refseq: XP_017641532.1 — PREDICTED: nuclear transcription factor Y subunit A-7-like
- Refseq: XP_017641533.1 — PREDICTED: nuclear transcription factor Y subunit A-7-like
- Refseq: XP_017642281.1 — PREDICTED: nuclear transcription factor Y subunit A-7-like
- Refseq: XP_017642282.1 — PREDICTED: nuclear transcription factor Y subunit A-7-like
- Swissprot: Q84JP1 — NFYA7_ARATH; Nuclear transcription factor Y subunit A-7
- TrEMBL: A0A0B0NSG0 — A0A0B0NSG0_GOSAR; Nuclear transcription factor Y subunit A-7-like protein
- TrEMBL: A0A1U8PF16 — A0A1U8PF16_GOSHI; nuclear transcription factor Y subunit A-7-like
- TrEMBL: A0A2P5XWA8 — A0A2P5XWA8_GOSBA; Uncharacterized protein
- STRING: Gorai.009G115000.1 — (Gossypium raimondii)
- GO:0006355 — Biological Process — regulation of transcription, DNA-templated
- GO:0016602 — Cellular Component — CCAAT-binding factor complex
- GO:0003677 — Molecular Function — DNA binding
- GO:0003700 — Molecular Function — transcription factor activity, sequence-specific DNA binding
Family Introduction
- NF-Y transcription factors are likely found in all eukaryotes and have roles in the regulation of diverse genes (McNabb et al., 1995; Edwards et al., 1998; Maity and de Crombrugghe, 1998; Mantovani, 1999). In mammals, where their biochemistry is well described, the NF-Y transcription factor complex is composed of three unique subunits: NF-YA, NF-YB, and NF-YC. Assembly of the NF-Y heterotrimer in mammals follows a strict, stepwise pattern (Sinha et al., 1995, 1996). Initially, a heterodimer is formed in the cytoplasm between the subunits NF-YB and NF-YC. This dimer then translocates to the nucleus, where the third subunit, NF-YA, is recruited to generate the mature, heterotrimeric NF-Y transcription factor (Frontini et al., 2004; Kahle et al., 2005). Mature NF-Y binds promoters with the core pentamer nucleotide sequence CCAAT, and this can result in either positive or negative transcriptional regulation(Peng and Jahroudi, 2002, 2003; Ceribelli et al., 2008).
- NF-YA proteins are characterized by the presence of Gln(Q)- and Ser/Thr(S/T)-rich NH2 termini, a subunit interaction domain (NF-YB/NF-YC interaction), and a DNA-binding domain (Olesen and Guarente, 1990; Maity and de Crombrugghe, 1992; Xing et al., 1993, 1994). The protein interaction and DNA binding domains are well conserved between plant and other eukaryote lineages.
Literature and News
Gene Resources
Homologs
- Citrus sinensis: orange1.1g028184m, orange1.1g027709m, orange1.1g026474m, orange1.1g027942m
- Gossypium arboreum: Cotton_A_10241_BGI-A2_v1.0, Cotton_A_26079_BGI-A2_v1.0
- Juglans regia: WALNUT_00020268-RA
- Manihot esculenta: Manes.06G054900.2.p, Manes.06G054900.1.p
- Populus trichocarpa: Potri.011G101000.1, Potri.011G098400.1
- Prunus mume: XP_008225593.1
- Prunus persica: Prupe.4G090200.1.p
- Pyrus bretschneideri: Pbr042102.1
- Vitis vinifera: GSVIVT01021622001
- Ziziphus jujuba: XP_015882438.1
Sequences
CDS Sequence:
- >Gh_A05G0961|Gossypium_hirsutum|NF-YA|Gh_A05G0961
ATGACTTCCTCTGCGCATGATCTTTCTGACAATAATGAAGTTGATGAACAGAAAATACACTCGGAGTTCAGTGATCACTCATCATCTCCTGTAACGGGACTTTCTCCCTCTTCTATCACCACCCCATACATGCCTTACACAACACCTCAACATGCTGTGGCACCGGCTGCTTACCCTTATCCAGATCCATATTATAGAAGCATCTTTGCACCCTATGATGCTCAATCATATCCCCCACAGCCCTATGGCGGTCAACCTATGGTCCACCTTCAGTTGATGGGTATTCAGCAAGCTGGAGTTCCCTTGCCATCAGATGCAGTTGAAGAGCCTGTCTTTGTTAATGCAAAACAATATCATGGCATCTTGCGACGTCGACAATCTCGTGCGAAAGCTGAATCAGAGAATAAACTTGCCAAGTCTAGGAAACCATACTTGCATGAATCCCGTCATTTGCATGCATTAAGAAGAGCCAGAGGATCTGGCGGTCGGTTTCTCAATTCGAAGAAAAATGAAAACAAACAGAATGAGGCTGCACCAAGTGATAAATCACAGTCCAATATCAATCTGAACTCTGACAAAAACGAGCTAGCTTCTACAGAGGGCAATTGTTGA
Protein Sequence:
- >Gh_A05G0961|Gossypium_hirsutum|NF-YA|Gh_A05G0961
MTSSAHDLSDNNEVDEQKIHSEFSDHSSSPVTGLSPSSITTPYMPYTTPQHAVAPAAYPYPDPYYRSIFAPYDAQSYPPQPYGGQPMVHLQLMGIQQAGVPLPSDAVEEPVFVNAKQYHGILRRRQSRAKAESENKLAKSRKPYLHESRHLHALRRARGSGGRFLNSKKNENKQNEAAPSDKSQSNINLNSDKNELASTEGNC